SecReT6
Protein ID: 385333208
SecReT6 ID604
T6SS typei1
Gene symbol-
Locus tagHP15_3467
StrainMarinobacter adhaerens HP15
Repliconchromosome [GenBank: NC_017506] [Browse all T6SS(s) in this replicon]
Location [Strand]3653408..3656041 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDE4PFG0
KEGG IDmad:HP15_3467
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.10E-38, Aligned region: 219..297
AAA_2 [PF07724], Evalue: 1.10E-38, Aligned region: 615..776
AAA [PF00004], Evalue: 1.50E-18, Aligned region: 221..351
AAA [PF00004], Evalue: 1.50E-18, Aligned region: 621..741
AAA_5 [PF07728], Evalue: 2.00E-14, Aligned region: 221..243
AAA_5 [PF07728], Evalue: 2.00E-14, Aligned region: 620..741
AAA_16 [PF13191], Evalue: 7.60E-14, Aligned region: 79..127
AAA_16 [PF13191], Evalue: 7.60E-14, Aligned region: 198..237
AAA_16 [PF13191], Evalue: 7.60E-14, Aligned region: 264..299
AAA_16 [PF13191], Evalue: 7.60E-14, Aligned region: 452..473
AAA_16 [PF13191], Evalue: 7.60E-14, Aligned region: 591..659
AAA_16 [PF13191], Evalue: 7.60E-14, Aligned region: 685..714
AAA_16 [PF13191], Evalue: 7.60E-14, Aligned region: 810..828
ClpB_D2-small [PF10431], Evalue: 7.90E-14, Aligned region: 135..154
ClpB_D2-small [PF10431], Evalue: 7.90E-14, Aligned region: 782..856
AAA_22 [PF13401], Evalue: 1.60E-08, Aligned region: 220..313
AAA_22 [PF13401], Evalue: 1.60E-08, Aligned region: 619..710
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 218..242
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 364..398
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 615..642
AAA_25 [PF13481], Evalue: 3.00E-05, Aligned region: 221..252
AAA_25 [PF13481], Evalue: 3.00E-05, Aligned region: 277..318
AAA_25 [PF13481], Evalue: 3.00E-05, Aligned region: 615..652
AAA_29 [PF13555], Evalue: 0.00018, Aligned region: 213..237
AAA_29 [PF13555], Evalue: 0.00018, Aligned region: 617..645
NACHT [PF05729], Evalue: 0.00055, Aligned region: 29..58
NACHT [PF05729], Evalue: 0.00055, Aligned region: 221..248
NACHT [PF05729], Evalue: 0.00055, Aligned region: 481..538
NACHT [PF05729], Evalue: 0.00055, Aligned region: 621..648
AAA_17 [PF13207], Evalue: 0.00078, Aligned region: 221..245
AAA_17 [PF13207], Evalue: 0.00078, Aligned region: 621..655
Arch_ATPase [PF01637], Evalue: 0.00093, Aligned region: 201..235
Arch_ATPase [PF01637], Evalue: 0.00093, Aligned region: 273..305
Arch_ATPase [PF01637], Evalue: 0.00093, Aligned region: 621..656
Arch_ATPase [PF01637], Evalue: 0.00093, Aligned region: 691..706
AAA_14 [PF13173], Evalue: 0.001, Aligned region: 289..402
AAA_14 [PF13173], Evalue: 0.001, Aligned region: 619..702
DUF258 [PF03193], Evalue: 0.0011, Aligned region: 200..238
DUF258 [PF03193], Evalue: 0.0011, Aligned region: 621..661
AAA_18 [PF13238], Evalue: 0.0026, Aligned region: 221..241
AAA_18 [PF13238], Evalue: 0.0026, Aligned region: 621..657
IstB_IS21 [PF01695], Evalue: 0.0037, Aligned region: 205..245
IstB_IS21 [PF01695], Evalue: 0.0037, Aligned region: 620..631
Sigma54_activat [PF00158], Evalue: 0.0045, Aligned region: 219..237
Sigma54_activat [PF00158], Evalue: 0.0045, Aligned region: 619..718
Protein Sequence: 877 a.a.     [Download]
>gi|385333208|ref|YP_005887159.1| type VI secretion ATPase, ClpV1 family [Marinobacter adhaerens HP15]
MIRVELPALIGRLNDMSRQALEASAALCISRQGAEITPAHLLFKLLETPFSDVRQILEHTGLEHQQLQPL
VGDSLNGESQSAEPYPSFSPLLVELMQDAWLLASTELGHTELRSGAVFLALLMNADRYLMPRVAKAMVDI
NREQLRKQFDRFTEGSAERLEPSEQEPGQPVASVDLDPLKRYATDFTRLAREDKLDPVVCRDAEIDQMID
ILCRRRKNNPIVVGDAGVGKSAVVEGLALRIVNGDVPDRLKSVELWTLDMGALQAGASVKGEFEKRLKGV
IEAVKGSATPIILFIDEAHTLIGAGNSEGGSDAANLLKPALARGELRTIAATTWREYKKYFEKDPALSRR
FQPVALDEPTPGEAVHILRGLRTVYEKAHQVLIADSALKAAAEMSARYLAGRQLPDKAIDVLDTACARVS
LNLSAPPRRLSRVRSELYQLAMEQNLLCREHTLGQTVDAERERELEQRVAGITVESAALEQRWSDQRELV
ARLVEIREKLLTGESQAEANTPELTDGITEERPDLKSEAAAIEQELTELQADEPLVHTRVDARQVAEVIA
DWTGIPVNRMTTDELEKITHLPAYLQEHIKGQDTAIDCLHQHLLTARADLRRPGRPMGAFLLVGPSGVGK
TETVVQLAELLYGGRQFLTTINMSEYQEKHTVSRLIGSPPGYVGFGEGGILTEAIRQKPYSVVLLDEVEK
AHPEVLNLFYQAFDKGELADGEGRLIDCKNVVFFLTSNLGYQTIVNHAESPASLDEALYPELASFFKPAL
LARMEVVPYLPLGEETLNRIVGDKLQRLADQIKARYHTEVELEEGLIEAIRNRATRSENGARMLESIIEG
ELLPPVSLALLEKLAAREPVKKVTLAVEEHRFVGTVA
 
Nucleotide Sequence: 2634 bp     [Download]
>gi|385329741|ref|NC_017506.1|:c3656041-3653408 Marinobacter adhaerens HP15 chromosome, complete genome
GTGATTCGGGTAGAACTGCCGGCGCTGATCGGGCGCCTCAACGACATGTCACGCCAGGCACTGGAAGCCT
CGGCCGCTTTGTGCATCAGCCGTCAGGGCGCGGAAATCACTCCGGCCCATTTGCTGTTCAAACTGCTTGA
AACGCCGTTTTCCGACGTGCGCCAGATTCTGGAGCACACCGGCCTTGAGCATCAGCAACTGCAACCGCTG
GTAGGCGATAGCCTGAACGGAGAGTCGCAAAGCGCTGAGCCCTACCCATCGTTCTCTCCGCTGTTGGTGG
AGCTGATGCAGGATGCCTGGCTGCTGGCTTCCACCGAACTGGGGCACACCGAATTGCGTTCCGGCGCGGT
ATTCCTTGCCCTGCTGATGAATGCCGATCGATACCTGATGCCCCGGGTGGCAAAGGCAATGGTGGACATC
AATCGTGAGCAGCTGCGCAAGCAATTTGACCGGTTCACCGAGGGCTCCGCGGAGAGACTGGAACCAAGCG
AGCAGGAACCCGGGCAACCAGTGGCCAGCGTGGATCTGGACCCGCTCAAACGCTACGCCACCGACTTCAC
CAGACTGGCCCGGGAGGACAAACTGGACCCCGTGGTTTGCCGTGACGCCGAGATCGACCAGATGATCGAC
ATCCTCTGCCGCCGCCGCAAGAACAACCCGATTGTGGTGGGCGATGCCGGTGTGGGCAAAAGCGCCGTGG
TGGAGGGCCTGGCTCTGCGCATCGTCAACGGCGACGTGCCTGACCGTTTGAAGAGCGTTGAGCTATGGAC
CCTGGACATGGGTGCCCTGCAGGCGGGCGCCTCCGTGAAGGGCGAGTTCGAGAAACGCCTCAAAGGCGTG
ATCGAGGCGGTCAAAGGCTCGGCTACCCCGATCATCCTGTTCATTGACGAAGCCCATACCCTGATTGGCG
CAGGCAACAGCGAAGGCGGCTCTGATGCTGCCAACCTGCTCAAACCTGCCCTTGCCAGGGGCGAGCTGCG
TACCATCGCAGCGACCACCTGGCGCGAATACAAGAAATACTTCGAAAAAGACCCAGCCCTGAGCCGCCGT
TTCCAGCCTGTGGCGCTGGATGAGCCCACTCCCGGGGAAGCGGTCCACATCCTCCGTGGCTTGCGCACCG
TCTATGAAAAAGCCCATCAGGTACTTATCGCCGACAGCGCCCTGAAAGCCGCCGCCGAAATGTCTGCCCG
TTACCTTGCCGGCCGTCAGCTACCGGACAAAGCCATCGACGTGCTGGATACCGCCTGCGCCCGCGTTAGC
CTGAATCTGAGCGCGCCGCCCAGACGCCTGAGCCGCGTCCGAAGCGAGCTGTATCAGCTGGCCATGGAAC
AGAACCTGCTGTGCCGGGAACACACCTTGGGACAGACCGTGGATGCCGAACGGGAACGGGAACTGGAACA
GCGCGTTGCCGGGATCACTGTTGAATCTGCAGCCCTGGAACAACGCTGGAGCGACCAGCGCGAACTGGTG
GCACGACTGGTGGAGATCCGGGAAAAGTTGCTTACCGGCGAATCGCAGGCTGAAGCGAATACCCCTGAAT
TGACCGATGGGATAACAGAAGAACGCCCGGACCTGAAAAGCGAAGCCGCCGCCATCGAGCAGGAACTGAC
GGAACTCCAGGCCGACGAGCCGTTGGTTCACACCCGGGTTGACGCCAGACAGGTGGCCGAAGTCATTGCC
GACTGGACTGGTATTCCGGTCAATCGCATGACCACCGACGAACTGGAAAAAATCACCCATTTGCCGGCGT
ATCTGCAGGAGCACATCAAAGGCCAGGACACCGCCATCGACTGCCTGCACCAACACCTGCTTACCGCCCG
CGCCGACCTGCGCCGGCCCGGCCGCCCCATGGGCGCCTTCCTGCTGGTGGGACCCAGCGGCGTTGGCAAA
ACCGAAACCGTGGTACAGCTGGCTGAACTCCTCTACGGCGGTCGTCAGTTCCTTACTACCATCAACATGT
CCGAATACCAGGAAAAACACACCGTCTCCCGTCTGATCGGCTCGCCCCCCGGCTATGTGGGTTTTGGTGA
AGGCGGCATCCTCACCGAAGCCATCCGCCAGAAACCCTACTCCGTGGTCTTGCTCGACGAAGTCGAAAAA
GCCCATCCGGAAGTCCTCAATCTGTTCTACCAGGCATTTGACAAAGGCGAACTGGCCGATGGCGAAGGCC
GTCTGATCGACTGCAAGAACGTGGTCTTCTTCCTCACCTCAAACCTCGGATACCAGACCATCGTCAACCA
CGCCGAGTCGCCGGCCAGCCTGGACGAAGCTCTCTACCCGGAACTGGCCAGCTTCTTCAAGCCGGCCTTG
CTGGCAAGAATGGAAGTGGTGCCCTACCTGCCTCTTGGCGAGGAAACCCTCAACCGAATCGTTGGCGACA
AACTCCAGCGCCTGGCAGACCAGATCAAGGCCCGCTACCACACCGAGGTGGAATTGGAAGAAGGACTTAT
CGAGGCTATTCGAAACCGTGCGACAAGAAGTGAAAATGGCGCAAGGATGCTTGAGTCGATCATAGAGGGT
GAGTTGTTGCCGCCTGTTTCACTCGCGTTGCTGGAGAAACTGGCGGCGAGGGAGCCGGTGAAAAAGGTGA
CACTGGCGGTCGAAGAGCATCGATTCGTAGGAACTGTTGCCTAG