SecReT6
Protein ID: 385333209
SecReT6 ID604
T6SS typei1
Gene symbol-
Locus tagHP15_3468
StrainMarinobacter adhaerens HP15
Repliconchromosome [GenBank: NC_017506] [Browse all T6SS(s) in this replicon]
Location [Strand]3656052..3656879 [-]
Producthypothetical protein
NoteTssL
UniProt IDE4PFG1
KEGG IDmad:HP15_3468
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-72, Aligned region: 53..259
Protein Sequence: 275 a.a.     [Download]
>gi|385333209|ref|YP_005887160.1| hypothetical protein HP15_3468 [Marinobacter adhaerens HP15]
MEDAQVMDLPNGSRNSGSSAFSDLIFADSRGAAEGNREGQVDEHFQLRGLEHNRLIDAATPLLGLVIRIR
RLADYRAVEILYQQVVDDISAIDRELVEQGYDRPVVVAYRYVLCAFIDEAVLGTDWGAHSIWSQHSLLSR
FHNETWGGEKVFAILARMEQEPARYRDMLSFIYLCLCLGFEGRYKVMENGRDEYDQIVRGLHEQLKALQE
EQEPAPLADARANVTPTRNRLRSGIPVWGIAGLFVAAMAGIYSLYNIALNERITDVLRVLDQLPK
 
Nucleotide Sequence: 828 bp     [Download]
>gi|385329741|ref|NC_017506.1|:c3656879-3656052 Marinobacter adhaerens HP15 chromosome, complete genome
ATGGAAGATGCACAGGTAATGGACTTACCCAATGGCAGCAGAAATTCCGGCAGCAGTGCGTTCAGTGATC
TGATTTTTGCCGACAGCCGGGGAGCAGCTGAGGGCAACAGGGAAGGCCAGGTCGACGAGCATTTTCAGCT
CAGAGGGTTGGAACATAACCGCCTGATTGACGCCGCCACACCATTGCTGGGCCTGGTGATCAGGATACGC
AGGTTGGCAGACTATCGCGCAGTGGAAATCCTCTACCAGCAGGTGGTGGATGATATCTCGGCCATCGACC
GGGAATTGGTGGAACAGGGTTACGACCGGCCGGTTGTAGTCGCCTATCGTTACGTCCTCTGCGCCTTCAT
CGACGAGGCCGTGCTGGGAACCGACTGGGGCGCCCATAGCATCTGGTCACAGCACTCCCTGCTGTCCCGC
TTCCACAACGAGACATGGGGTGGAGAAAAGGTCTTTGCCATTCTTGCCCGGATGGAGCAGGAGCCGGCCC
GTTATCGCGACATGCTGTCGTTTATCTATCTGTGTCTCTGTCTGGGTTTCGAGGGGCGATACAAGGTGAT
GGAAAACGGCCGCGATGAATACGACCAGATTGTCCGTGGCCTGCACGAGCAACTGAAAGCGTTGCAGGAG
GAGCAGGAACCGGCGCCTCTTGCGGATGCCCGGGCGAATGTAACGCCAACCCGGAACCGGTTGCGCAGCG
GCATACCTGTCTGGGGCATTGCTGGTCTGTTTGTGGCGGCCATGGCCGGCATCTACTCCCTGTATAACAT
CGCACTGAACGAGCGCATCACGGACGTATTGCGCGTACTCGACCAACTACCGAAATAA