SecReT6
Protein ID: 385333210
SecReT6 ID604
T6SS typei1
Gene symbol-
Locus tagHP15_3469
StrainMarinobacter adhaerens HP15
Repliconchromosome [GenBank: NC_017506] [Browse all T6SS(s) in this replicon]
Location [Strand]3656883..3658217 [-]
Producthypothetical protein
NoteTssK
UniProt IDE4PFG2
KEGG IDmad:HP15_3469
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.00E-163, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|385333210|ref|YP_005887161.1| hypothetical protein HP15_3469 [Marinobacter adhaerens HP15]
MAVINRVVWSDGLFIKPQHFQQQQRYLEHQINERALAISDYLYGFSDLELNAEYLSFGRVGLVRASGLFP
DGTRFSLPQDDVMPEPLEIADASVANQVVYLALPLGSESLAEVEWPDAPVAGRFRADSREIRDLHSIDGD
AHAIDVGRVAPRLMLEREDRSAYAALAIGRILEKRPDGSLVMDPNFLPTMLSVRAAPRLQRFVGEMAGLM
RERARNIAERVGAPGQGGVADVADFMLLQMLNRAHPRFMHLARLRQLHPERLFEALLELCGELVTFTDEG
RLPREYPAYDHDLPEDAFTPLMQVLRQSLSTVLEPRALAIQLQQRQYGLTVAPVQDAQLVRDAEFILAVK
ADMPLDDLRKQFTQQCKVASVEKIRDLISLQLPGIPLAALPVAPRQLPYHAGFVYFRLDDQSQAWQMLDN
ASGFAFHVAGSFPGMEMQFWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|385329741|ref|NC_017506.1|:c3658217-3656883 Marinobacter adhaerens HP15 chromosome, complete genome
ATGGCGGTAATCAATCGAGTCGTCTGGAGTGATGGCCTGTTTATCAAGCCTCAACATTTCCAGCAACAGC
AGCGATATCTGGAACATCAGATCAATGAACGGGCGCTCGCGATCTCTGATTATCTGTATGGCTTCAGCGA
CCTGGAGCTGAATGCGGAGTATCTGAGTTTCGGCCGGGTTGGCCTGGTTAGGGCATCCGGACTGTTCCCG
GACGGAACCCGCTTCAGCCTGCCCCAGGACGATGTGATGCCTGAACCGTTGGAAATTGCCGATGCCTCGG
TGGCCAATCAGGTCGTCTACCTGGCGTTGCCGTTGGGCAGTGAAAGCCTGGCTGAAGTGGAATGGCCGGA
CGCCCCGGTGGCCGGCCGGTTCCGTGCCGACTCCCGGGAAATCCGGGATCTGCATTCGATTGACGGCGAT
GCCCACGCCATTGATGTGGGTCGCGTGGCACCCCGCCTGATGCTGGAGAGGGAAGATCGCAGCGCCTATG
CGGCCCTGGCTATCGGCCGGATTCTTGAAAAGCGCCCGGACGGAAGCCTGGTGATGGATCCGAACTTCCT
ACCCACCATGCTGAGTGTGCGAGCTGCACCCAGGCTGCAGCGATTTGTCGGTGAAATGGCGGGACTGATG
CGGGAACGGGCGCGCAATATTGCCGAACGTGTCGGTGCCCCTGGGCAGGGCGGCGTTGCAGACGTGGCGG
ATTTCATGTTGCTGCAGATGCTGAATCGCGCCCACCCCAGGTTCATGCATCTGGCTCGCCTTCGCCAGTT
GCATCCTGAAAGGCTGTTCGAAGCCCTGCTTGAACTTTGTGGTGAGCTGGTGACCTTCACCGATGAAGGG
CGTTTGCCGAGGGAGTATCCGGCCTATGACCACGATCTCCCGGAGGATGCTTTTACCCCGCTCATGCAGG
TTCTGCGGCAGTCCCTGAGCACAGTGCTGGAACCGAGGGCCCTGGCTATCCAGCTCCAGCAGCGCCAGTA
CGGCCTGACTGTGGCCCCGGTTCAGGATGCCCAGTTGGTCCGGGATGCGGAATTCATTCTGGCGGTCAAA
GCCGACATGCCACTGGACGATCTGCGCAAGCAGTTCACTCAGCAGTGCAAGGTGGCCTCTGTGGAAAAAA
TCCGGGATCTGATCAGCCTGCAGCTGCCGGGGATTCCGCTTGCTGCATTGCCGGTTGCACCCCGGCAGTT
GCCGTACCACGCCGGCTTCGTGTACTTCCGCCTGGACGACCAGAGCCAGGCCTGGCAAATGCTCGACAAC
GCCAGCGGCTTCGCATTCCACGTGGCCGGCAGTTTCCCGGGCATGGAAATGCAGTTCTGGGCAATCAGGA
GCTAA