SecReT6
Protein ID: 385333211
SecReT6 ID604
T6SS typei1
Gene symbol-
Locus tagHP15_3470
StrainMarinobacter adhaerens HP15
Repliconchromosome [GenBank: NC_017506] [Browse all T6SS(s) in this replicon]
Location [Strand]3658217..3658750 [-]
Productlipoprotein
NoteTssJ
UniProt IDE4PFG3
KEGG IDmad:HP15_3470
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-34, Aligned region: 13..169
Protein Sequence: 177 a.a.     [Download]
>gi|385333211|ref|YP_005887162.1| lipoprotein [Marinobacter adhaerens HP15]
MKTCKWSLLAVVFVLAGCSTPYNAVTKTAKVLWDPDIPVGYPEDLPSRVGLTMVAEPDVNPNESLAPTPI
AFQIIEMRDSSLLMAGDFDQLLSDLESSLGQNYVDHSDYSLVPGQFKFIEPFEIGEDTRFIGVIAFYAYP
NLSQWKKVVKVDPIGGRYNLLVNLREREVQLKHSDDT
 
Nucleotide Sequence: 534 bp     [Download]
>gi|385329741|ref|NC_017506.1|:c3658750-3658217 Marinobacter adhaerens HP15 chromosome, complete genome
GTGAAGACCTGCAAATGGAGTTTGCTGGCCGTCGTATTCGTGCTTGCCGGATGCAGCACGCCCTATAACG
CCGTCACCAAAACCGCAAAAGTGCTCTGGGACCCGGATATCCCGGTGGGGTACCCGGAGGATCTGCCTAG
CCGGGTAGGTCTGACCATGGTGGCCGAACCGGATGTAAACCCGAATGAATCCCTGGCACCCACGCCCATT
GCGTTTCAGATCATCGAGATGCGCGACAGCTCACTATTGATGGCCGGGGATTTCGACCAGCTACTGAGTG
ACCTCGAGTCGTCACTGGGCCAGAACTATGTGGACCACAGCGATTACTCCCTGGTGCCAGGCCAGTTCAA
GTTCATCGAACCCTTCGAGATTGGCGAGGACACCCGATTTATCGGCGTGATCGCGTTTTACGCCTACCCC
AACCTGTCCCAGTGGAAGAAGGTGGTGAAGGTGGATCCAATCGGCGGCCGCTACAACCTGCTGGTGAACC
TGCGGGAGCGGGAAGTTCAACTCAAGCATTCGGATGACACCTGA