SecReT6
Protein ID: 385333212
SecReT6 ID604
T6SS typei1
Gene symbol-
Locus tagHP15_3471
StrainMarinobacter adhaerens HP15
Repliconchromosome [GenBank: NC_017506] [Browse all T6SS(s) in this replicon]
Location [Strand]3658747..3660045 [-]
Producttype VI secretion system, FHA domain-containing protein
NoteFha
UniProt IDE4PFG4
KEGG IDmad:HP15_3471
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 8.50E-07, Aligned region: 47..96
Protein Sequence: 432 a.a.     [Download]
>gi|385333212|ref|YP_005887163.1| type VI secretion system, FHA domain-containing protein [Marinobacter adhaerens HP15]
MGLKLTVTNPTVAGGGATIDHCFSVRGGSIGTAASDTWRLSSHRTGAVPGHAEIRFLDGGFCLIDRSGRT
YINSASQPVGRGRRARLNHGDTISIGRYQLRAELAEVVSEPLLERGEADQARQLIDVDEGPLMRAEYLTS
QTENPEPLQNFGAVAGEAVSDDPLAPWNLQPDQQKSDADALMVSETSWRAAERQVSDEYRENRDVAMGLP
VRKGEKDRMSEISESADRREVSDQSSKHISGAPLLRGMEVGLDFADSDEMRLFLEEVGQTLKSTVEGLLA
LHQGEDSRHQALRTRLQPIEDNPLRLGEGYEDTVQTLFASHRSPVHLSAPAAVRESLQSLNHHQQATREA
ISEALEAILHAFSPEALLRRFHGYRRGLRQNEDEGRWAWDMYQHYYRELKSSRQQGFERLFQEVFEQAYD
QNLRQLQRENPL
 
Nucleotide Sequence: 1299 bp     [Download]
>gi|385329741|ref|NC_017506.1|:c3660045-3658747 Marinobacter adhaerens HP15 chromosome, complete genome
GTGGGACTCAAACTGACAGTCACCAATCCGACTGTTGCTGGCGGCGGGGCAACCATCGACCACTGCTTCA
GTGTTCGTGGCGGCTCTATCGGTACAGCAGCCAGTGATACCTGGCGGTTATCGTCCCACCGAACGGGTGC
GGTTCCCGGCCACGCGGAGATCCGTTTTCTGGACGGCGGCTTCTGCCTGATTGATCGCAGTGGCCGGACC
TACATCAATAGCGCAAGTCAGCCGGTGGGTCGGGGCCGTCGGGCACGACTGAATCATGGCGATACCATCA
GTATTGGTCGCTATCAACTTCGTGCGGAGTTGGCCGAGGTTGTAAGTGAACCGTTGCTTGAGAGAGGTGA
AGCAGATCAGGCCCGGCAACTGATTGATGTCGATGAAGGGCCGCTGATGCGGGCCGAGTACTTAACCAGC
CAGACTGAGAACCCAGAGCCGCTGCAGAATTTTGGCGCGGTAGCCGGGGAGGCAGTCAGTGATGACCCAT
TGGCACCCTGGAACCTACAGCCGGACCAACAGAAGTCGGATGCTGACGCGCTGATGGTCAGCGAGACCTC
CTGGCGCGCCGCCGAAAGGCAGGTTTCGGATGAGTACCGTGAAAACCGCGACGTAGCGATGGGCCTGCCA
GTTCGCAAAGGAGAGAAAGACAGGATGTCTGAGATTTCAGAGAGCGCTGATCGCAGGGAGGTTTCCGATC
AGAGCAGCAAGCACATCAGTGGTGCCCCCCTGTTGCGGGGTATGGAAGTCGGGCTGGACTTTGCCGACAG
CGACGAGATGCGTCTGTTCCTGGAGGAAGTAGGGCAAACACTGAAGTCGACCGTGGAAGGCCTGTTGGCC
CTGCATCAGGGAGAAGACAGCAGGCATCAGGCGCTGCGAACCCGCCTGCAACCCATCGAGGATAATCCAC
TGCGGTTGGGTGAGGGTTATGAGGATACGGTGCAGACCCTGTTCGCCAGCCATCGTAGCCCGGTTCACCT
GTCGGCGCCGGCGGCGGTGCGGGAGAGTCTGCAGAGCCTGAATCATCACCAGCAGGCAACCCGTGAGGCC
ATCAGCGAGGCATTGGAGGCCATCCTGCATGCCTTTTCGCCCGAGGCCTTGCTGCGTCGTTTCCATGGTT
ACCGCCGGGGACTGCGCCAGAACGAGGACGAGGGACGCTGGGCATGGGATATGTACCAGCATTATTACCG
AGAGTTGAAATCCAGTCGTCAGCAGGGATTCGAGCGTCTGTTCCAGGAAGTGTTCGAACAGGCTTACGAC
CAGAACCTGCGCCAACTACAGAGGGAGAACCCGTTGTGA