SecReT6
Protein ID: 385333213
SecReT6 ID604
T6SS typei1
Gene symbol-
Locus tagHP15_3472
StrainMarinobacter adhaerens HP15
Repliconchromosome [GenBank: NC_017506] [Browse all T6SS(s) in this replicon]
Location [Strand]3660084..3661010 [-]
Producthypothetical protein
NoteTssG
UniProt IDE4PFG5
KEGG IDmad:HP15_3472
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-96, Aligned region: 2..291
Protein Sequence: 308 a.a.     [Download]
>gi|385333213|ref|YP_005887164.1| hypothetical protein HP15_3472 [Marinobacter adhaerens HP15]
MDLIHRHHGDDLERNSDDQPRQERIRFSASAGLGFPGSDVVSALSPEHEHAPYQMEVSFLGLHGSQSPLP
GYYLEDLAWEAGQNLGIRRHFLDFFNHRLVTLFHRAWRKYRYYVRFQPGASDGFSELIFALIGLGDSRLR
EATPVNWSKMLAYSGLMAGRSRSPEVVSGIVAHCFDLDDVSIEQWVLRKVAIADDQQTRLGQANACLGSD
TLVGSAIRDRSGKFVLRLRNLSRQRFADFLPNGQDHQRLVKLVEFTTREQLAYDLELQMRPKDIRPMELG
EDVRLGWNSFVTPEKARRRPAVRIQIRR
 
Nucleotide Sequence: 927 bp     [Download]
>gi|385329741|ref|NC_017506.1|:c3661010-3660084 Marinobacter adhaerens HP15 chromosome, complete genome
GTGGACCTTATTCACCGGCACCACGGGGATGACCTGGAGCGAAACAGCGACGATCAACCCCGCCAGGAAA
GGATCCGGTTTTCTGCCTCTGCGGGGCTGGGGTTTCCCGGTAGCGATGTGGTTTCGGCGCTGTCGCCGGA
GCACGAGCACGCCCCGTATCAGATGGAAGTCAGCTTTCTGGGATTGCACGGCTCACAGTCGCCGTTGCCG
GGCTATTACCTTGAAGACCTGGCCTGGGAAGCGGGGCAGAATCTGGGCATCCGGCGGCATTTTCTTGATT
TTTTCAATCATCGCCTGGTCACGCTGTTCCACCGGGCATGGCGCAAGTATCGCTACTACGTTCGGTTTCA
ACCCGGTGCCTCGGACGGCTTTTCAGAGCTGATCTTTGCCCTGATAGGTCTGGGCGACAGCCGGTTGCGG
GAGGCGACACCGGTGAACTGGTCCAAGATGCTGGCCTATTCCGGCCTGATGGCCGGTCGTAGCCGGTCGC
CTGAGGTGGTGAGCGGCATCGTTGCCCATTGCTTCGATCTGGATGATGTCAGTATTGAACAGTGGGTCCT
GCGCAAGGTGGCCATCGCCGATGATCAGCAGACCCGACTGGGCCAGGCTAACGCCTGTCTGGGCAGCGAC
ACACTGGTGGGATCGGCCATTCGGGATCGCAGTGGTAAATTCGTGCTCCGGTTGCGAAATCTCAGCCGAC
AGCGCTTTGCGGATTTCCTGCCTAATGGCCAGGACCACCAACGCCTGGTCAAGCTCGTTGAGTTCACCAC
ACGGGAGCAGCTGGCGTACGACCTGGAGCTTCAAATGCGTCCAAAAGACATCCGTCCCATGGAGCTGGGA
GAAGATGTGCGGCTGGGCTGGAATTCCTTCGTGACCCCGGAAAAGGCCAGGCGCCGACCGGCGGTCCGGA
TCCAGATTCGCCGGTGA