SecReT6
Protein ID: 385333214
SecReT6 ID604
T6SS typei1
Gene symbol-
Locus tagHP15_3473
StrainMarinobacter adhaerens HP15
Repliconchromosome [GenBank: NC_017506] [Browse all T6SS(s) in this replicon]
Location [Strand]3661064..3662836 [-]
Producttype VI secretion system, VCA0110
NoteTssF
UniProt IDE4PFG6
KEGG IDmad:HP15_3473
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-209, Aligned region: 3..590
Protein Sequence: 590 a.a.     [Download]
>gi|385333214|ref|YP_005887165.1| type VI secretion system, VCA0110 [Marinobacter adhaerens HP15]
MRLNRFYRDELSFLRLQGREFADAHPQLTRFLSEQSTDPDVERLLEGFAFLTGKLREKVEDEFPEITHSL
LNMLWPNYLRPVPSCTIMRFDPQLHAISERQRVERHTEIKSRPLGDANRQTQCRFRTCRAVDVFPVSVAA
AHAEHSREVSSVTVDLALHTDQPLSSLGMDSLRFYLGGESHVAETLFLWLNHYLKRIDLVVGDAVYRLPA
SLLRPVGFGNEEALLPYPKNAYPGYRILQEYLSFPEAFRFVDILGLGRRLPALQADEISLRFHFSRILPP
DAKVREDNFQLYCTPAVNLFTHEGEPVDLNGRQTEYRISPSSRSPDHYEVFSIEQVEGWLEGRSGRGEPR
IYTPFESFQHEVERDRGRTALYYRVRARDSVRGDGFDHYMSFVRGDESECLSRQEAVSLTLTCTNRHLPS
QLAVGEICMATESTPAFAAFSNITRPTATLRPTLDGSLLWTLISNLSLNYLSMLDVDALRTVLRVYDFRA
LVDRQAERVSQKRLAGITCIETAPVDRMVKGLPVRGIRSVLKLEQQAFASEGDLYLFGTVLSQFFALYAS
INAFHQLEVVNTDNQERYTWTLQQGQQPLM
 
Nucleotide Sequence: 1773 bp     [Download]
>gi|385329741|ref|NC_017506.1|:c3662836-3661064 Marinobacter adhaerens HP15 chromosome, complete genome
ATGAGGTTAAATCGGTTCTACAGAGACGAGTTAAGTTTTCTCAGGCTTCAGGGCCGGGAATTCGCAGATG
CCCATCCACAGCTGACGCGGTTCCTCTCAGAGCAGAGTACCGATCCGGATGTGGAGCGGCTGCTGGAAGG
CTTCGCTTTCCTGACCGGCAAACTGCGGGAAAAGGTTGAGGACGAGTTTCCGGAGATCACGCACTCGCTG
CTGAACATGTTGTGGCCGAATTATCTGCGGCCGGTACCCAGTTGCACGATCATGCGCTTCGATCCGCAGT
TGCATGCAATCAGTGAACGCCAGAGAGTAGAGCGTCATACCGAGATCAAGAGCCGTCCCCTGGGCGATGC
GAATCGCCAGACCCAGTGTCGGTTCCGCACTTGCCGGGCGGTGGATGTATTTCCTGTGAGCGTTGCCGCG
GCCCATGCAGAGCACTCACGGGAAGTGTCCTCAGTGACCGTGGACCTGGCACTGCACACCGATCAGCCCC
TGTCGTCACTGGGCATGGACAGCCTGCGCTTTTATCTGGGCGGCGAGAGCCATGTCGCCGAAACCCTTTT
TCTCTGGTTGAACCACTATCTGAAACGCATCGATCTGGTGGTGGGCGACGCTGTTTACCGCCTGCCTGCC
TCGCTTTTGCGGCCGGTCGGTTTTGGCAACGAAGAGGCCCTGTTGCCGTATCCCAAGAACGCCTACCCCG
GTTACCGCATTCTGCAGGAGTATCTCAGTTTCCCGGAGGCCTTCCGTTTTGTGGATATTCTCGGACTCGG
GCGTCGGCTGCCAGCGCTGCAGGCCGACGAAATCAGCCTGCGTTTCCATTTCAGCCGGATATTGCCACCG
GATGCAAAAGTGCGGGAGGACAATTTCCAGCTCTATTGTACCCCGGCGGTGAACCTGTTTACCCACGAAG
GTGAGCCGGTGGACCTGAACGGTCGCCAGACCGAATACCGGATTTCGCCTTCCAGCCGCTCGCCGGATCA
CTACGAGGTGTTCAGCATTGAGCAGGTGGAAGGCTGGCTGGAGGGACGGTCCGGGCGCGGTGAGCCCCGC
ATCTACACGCCCTTTGAGAGTTTCCAGCATGAGGTGGAGCGGGATCGAGGACGGACCGCCCTGTACTATC
GGGTCCGGGCCCGGGATAGCGTGCGCGGGGACGGCTTTGATCATTATATGTCGTTTGTCCGGGGCGACGA
GTCGGAGTGCCTGAGCCGGCAGGAAGCGGTTTCCCTGACCCTCACCTGCACCAACCGCCACTTGCCCAGC
CAACTGGCGGTAGGCGAAATCTGCATGGCGACCGAGAGCACGCCGGCGTTTGCCGCCTTCAGCAACATTA
CCCGGCCCACGGCGACCCTGCGGCCAACCCTGGATGGCAGCCTTTTGTGGACGCTGATCTCGAATCTGTC
ACTCAATTACCTGTCCATGCTGGACGTGGATGCTCTGCGCACGGTGCTTCGAGTTTATGATTTCCGGGCT
CTGGTGGACCGTCAGGCGGAGCGGGTATCACAGAAGCGTCTTGCTGGTATTACCTGTATCGAGACGGCTC
CGGTTGACCGGATGGTCAAAGGCCTGCCGGTGCGGGGGATTCGCTCGGTATTGAAACTGGAGCAGCAGGC
CTTTGCATCGGAGGGTGATCTTTACCTGTTCGGCACGGTACTCAGCCAGTTCTTTGCTCTTTACGCCAGT
ATCAACGCATTTCACCAACTGGAAGTGGTGAACACCGATAACCAGGAACGGTACACATGGACGTTACAGC
AAGGTCAGCAGCCGCTGATGTAG