SecReT6
Protein ID: 385333215
SecReT6 ID604
T6SS typei1
Gene symbol-
Locus tagHP15_3474
StrainMarinobacter adhaerens HP15
Repliconchromosome [GenBank: NC_017506] [Browse all T6SS(s) in this replicon]
Location [Strand]3662983..3663423 [-]
Producttype VI secretion system, lysozyme-related protein
NoteTssE
UniProt IDE4PFX4
KEGG IDmad:HP15_3474
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-20, Aligned region: 37..125
Protein Sequence: 146 a.a.     [Download]
>gi|385333215|ref|YP_005887166.1| type VI secretion system, lysozyme-related protein [Marinobacter adhaerens HP15]
MFQHPASDGSQASSGSLFERLEQAAEPAGQSTGDVTRVVESIKRHLVRLLNAHPGNSASVPDLGLLDFND
ATLGTHDLSVQIRGAIRQCIEKFEPRVKRVDVVNLPQGPDPLQLRFQVTVYLNVGSKDDKTTIDLVLDDK
RYYQVV
 
Nucleotide Sequence: 441 bp     [Download]
>gi|385329741|ref|NC_017506.1|:c3663423-3662983 Marinobacter adhaerens HP15 chromosome, complete genome
GTGTTCCAGCACCCGGCCAGCGACGGATCGCAGGCCAGCAGCGGCAGCCTGTTCGAGAGACTCGAGCAGG
CTGCTGAACCGGCTGGCCAGAGTACGGGAGACGTGACCCGCGTTGTTGAATCGATCAAGCGCCACCTGGT
TCGGCTGCTGAATGCCCACCCGGGCAACAGTGCCAGCGTACCGGATCTGGGCCTGCTGGACTTCAACGAC
GCCACGCTCGGCACCCACGATCTGAGCGTCCAGATTCGTGGCGCGATCCGGCAGTGCATCGAGAAGTTCG
AGCCCAGGGTGAAGCGGGTGGATGTCGTTAATTTGCCCCAGGGCCCTGATCCGTTACAGCTGCGGTTTCA
GGTGACGGTCTATCTGAACGTCGGTTCGAAAGACGACAAAACAACCATAGATTTGGTATTGGATGACAAA
CGTTACTACCAGGTGGTGTAA