SecReT6
Protein ID: 385333216
SecReT6 ID604
T6SS typei1
Gene symbol-
Locus tagHP15_3475
StrainMarinobacter adhaerens HP15
Repliconchromosome [GenBank: NC_017506] [Browse all T6SS(s) in this replicon]
Location [Strand]3663427..3664908 [-]
Producthypothetical protein
NoteTssC
UniProt IDE4PFX5
KEGG IDmad:HP15_3475
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.00E-192, Aligned region: 66..491
Protein Sequence: 493 a.a.     [Download]
>gi|385333216|ref|YP_005887167.1| hypothetical protein HP15_3475 [Marinobacter adhaerens HP15]
MSDTAVQQSAASESVTEGSLLDQVMANSRMAPADEGYDVARKGVATFIANLLKSDEKGQPVNKALVDQMV
VELDRKISAQMDEILHAPKLQELESSWRGLKLMVDRTDFRENIKVDILHATKTELLEDFEFAPDVTQTGF
YKHIYSTEYGQFGGEPVGAVVGNYAFTPSTPDMKLLQYVSSVGAMAHAPFLSSVAPSFFGVDSYQELPAI
KELKAVFEGPKYAKWRSLRESEDARYLGLTSPRFLLRVPYDPTENPVRSFNYKEDVSGDHEHYLWGNTAY
LLATRLTESFAKYRWCPNIIGPQSGGAVEDLPVHLFESFGQLEAKIPTEVLITDRREYEMADEGFIALTM
RKGSDNAAFFSANSVQKPKQFPNTKEGKEAETNYKLGTQLPYMMIVNRLAHYIKVLQREQIGSWKERQDL
ERELNTWIRQYVADQENPPAEVRSRRPLRAAQVTVSDVEGDPGWYQVSLAVRPHFKYMGANFELSLVGRL
DKD
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|385329741|ref|NC_017506.1|:c3664908-3663427 Marinobacter adhaerens HP15 chromosome, complete genome
ATGTCTGATACTGCTGTGCAGCAATCTGCTGCCTCCGAATCCGTCACTGAAGGCTCTCTCCTCGACCAGG
TCATGGCCAACAGCCGCATGGCGCCGGCGGATGAGGGTTACGATGTCGCTCGCAAGGGCGTGGCAACATT
TATAGCCAATCTGCTGAAAAGCGATGAAAAAGGTCAGCCGGTGAATAAGGCCCTGGTGGACCAGATGGTG
GTGGAGCTGGATCGAAAGATCAGCGCCCAGATGGATGAAATCCTGCACGCGCCCAAGCTGCAGGAGCTGG
AATCTTCCTGGCGCGGCCTGAAGCTCATGGTGGACCGCACCGATTTCCGTGAGAACATCAAGGTGGATAT
CCTCCACGCCACCAAGACCGAGCTGCTGGAAGACTTCGAGTTCGCGCCGGACGTTACCCAGACCGGTTTC
TACAAGCACATCTATTCCACGGAATATGGCCAGTTCGGTGGTGAACCGGTCGGCGCGGTTGTTGGCAACT
ACGCCTTTACCCCGTCCACACCCGACATGAAGTTGCTGCAGTACGTATCGTCCGTCGGAGCGATGGCCCA
TGCTCCGTTTCTGTCCTCGGTGGCACCGTCGTTCTTTGGCGTCGACAGCTACCAGGAACTACCTGCCATC
AAGGAACTGAAGGCCGTTTTCGAAGGCCCGAAATACGCCAAGTGGCGCTCCCTGCGGGAATCCGAAGATG
CCCGCTACCTGGGCCTGACTTCGCCGCGCTTCCTGCTGCGGGTGCCTTACGACCCCACCGAAAACCCGGT
GCGCAGCTTCAACTACAAAGAAGATGTGTCGGGTGACCATGAGCACTACCTGTGGGGCAATACCGCCTAC
CTGCTGGCCACCCGCCTGACGGAAAGCTTCGCCAAGTACCGCTGGTGCCCGAACATCATCGGTCCCCAAA
GCGGTGGTGCAGTCGAGGACCTGCCAGTGCACCTGTTCGAATCCTTTGGTCAACTGGAAGCCAAGATCCC
GACCGAAGTGCTGATCACCGATCGTCGTGAATACGAAATGGCCGACGAAGGCTTCATTGCCCTGACCATG
CGTAAAGGCAGCGATAACGCTGCGTTTTTCTCCGCCAACTCGGTGCAGAAACCCAAGCAGTTCCCTAACA
CCAAGGAAGGGAAGGAAGCGGAAACCAACTACAAACTGGGTACCCAGCTGCCCTACATGATGATCGTGAA
CCGCCTGGCCCACTACATCAAGGTCCTGCAGCGGGAGCAGATCGGCTCCTGGAAGGAACGTCAGGATCTG
GAGCGGGAGCTGAACACCTGGATACGTCAGTACGTGGCCGACCAGGAAAACCCGCCCGCCGAAGTCCGCA
GCCGTCGCCCCCTGCGCGCGGCACAGGTCACCGTTTCTGACGTGGAAGGTGATCCGGGCTGGTACCAGGT
GTCCCTGGCGGTTCGGCCCCACTTCAAGTACATGGGTGCTAACTTCGAACTGTCACTGGTTGGCCGGCTG
GACAAGGATTAA