SecReT6
Protein ID: 385333217
SecReT6 ID604
T6SS typei1
Gene symbol-
Locus tagHP15_3476
StrainMarinobacter adhaerens HP15
Repliconchromosome [GenBank: NC_017506] [Browse all T6SS(s) in this replicon]
Location [Strand]3664965..3665462 [-]
Producthypothetical protein
NoteTssB
UniProt IDE4PFX6
KEGG IDmad:HP15_3476
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.70E-58, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|385333217|ref|YP_005887168.1| hypothetical protein HP15_3476 [Marinobacter adhaerens HP15]
MSSKDGSVAPKERINIKYVPATGDQQAETELPLKMFVVGDFKGHAEETPIEDRKAISVDKNNFRSVMKEA
GLTLSTTVTNKLDEEADELPVNLEFQTLDDFSPDSVARQVPELNKLIELREALVALKGPLGNVPSFRSKL
QELLDNDDARDKLLAELELATDSNE
 
Nucleotide Sequence: 498 bp     [Download]
>gi|385329741|ref|NC_017506.1|:c3665462-3664965 Marinobacter adhaerens HP15 chromosome, complete genome
ATGTCTTCAAAAGACGGTTCCGTCGCGCCTAAAGAGCGCATCAATATCAAGTACGTCCCCGCCACCGGAG
ATCAGCAGGCAGAAACCGAGTTGCCGCTGAAGATGTTCGTGGTTGGTGATTTCAAGGGACACGCAGAAGA
AACCCCCATCGAAGACCGCAAGGCCATTTCCGTCGACAAGAACAACTTCCGTTCGGTCATGAAGGAAGCC
GGCCTGACCCTTTCCACCACCGTGACCAACAAGCTGGATGAGGAAGCCGACGAACTGCCGGTAAACCTGG
AATTCCAGACCCTTGATGACTTCTCTCCCGACAGCGTTGCCCGTCAGGTTCCGGAGCTGAACAAGCTGAT
TGAACTGCGGGAAGCCCTGGTGGCCCTGAAAGGCCCATTGGGTAACGTACCGTCGTTCCGTTCCAAGCTT
CAGGAACTGCTGGACAACGACGACGCCCGGGACAAGCTGCTGGCCGAACTGGAATTGGCCACAGACAGCA
ACGAGTAA