SecReT6
Protein ID: 385785916
SecReT6 ID601
T6SS typei3
Gene symbol-
Locus tagEJP617_04570
StrainErwinia sp. Ejp617
Repliconchromosome [GenBank: NC_017445] [Browse all T6SS(s) in this replicon]
Location [Strand]502863..503729 [-]
Producthypothetical protein
NotePAAR
UniProt IDE3DET5
KEGG IDerj:EJP617_04570
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 8.10E-20, Aligned region: 12..77
DUF4150 [PF13665], Evalue: 0.00024, Aligned region: 20..40
DUF4150 [PF13665], Evalue: 0.00024, Aligned region: 46..72
DUF4150 [PF13665], Evalue: 0.00024, Aligned region: 156..173
DUF4150 [PF13665], Evalue: 0.00024, Aligned region: 193..221
Protein Sequence: 288 a.a.     [Download]
>gi|385785916|ref|YP_005817025.1| hypothetical protein EJP617_04570 [Erwinia sp. Ejp617]
MGKPAARALIDKGAYSGPIQSGSPDVMIGGFPAARKGDSVSCSQHGSGIIVGGSASVIVNGQPLARLGDK
TQCQTGGKPPVPPKKAAPPQYWGATLAKNAAKDGLLHGDLYDARALGAFGSTEDKTGEGDSDTASLGFAL
TDLTLGNMKSDSLLRGESRTKVASGNASGTYYGYSHDSDITGFNANASASGVQYGATAAAGKQGVLYGSV
TGDVTVVTAETKLIGEVYKGNQGRYGFTSEAGAETAVVKGEGAVNFDIYGVFVSEAKLGGNGRWRGGSCG
IYRLLGYH
 
Nucleotide Sequence: 867 bp     [Download]
>gi|385785459|ref|NC_017445.1|:c503729-502863 Erwinia sp. Ejp617 chromosome, complete genome
ATGGGTAAGCCAGCGGCCAGAGCGCTTATTGATAAAGGCGCTTATAGCGGCCCAATACAATCCGGAAGCC
CCGATGTGATGATTGGTGGTTTTCCGGCGGCAAGAAAAGGCGACAGCGTAAGCTGTTCACAGCACGGCAG
CGGCATTATCGTCGGAGGTTCTGCCAGCGTTATCGTTAATGGACAACCGCTGGCGAGGCTGGGAGACAAA
ACCCAGTGTCAAACCGGCGGCAAACCGCCCGTTCCGCCGAAAAAAGCCGCCCCGCCGCAGTACTGGGGCG
CAACGTTAGCTAAAAACGCGGCAAAAGACGGGTTATTACACGGCGACCTCTACGACGCGCGCGCACTGGG
GGCTTTTGGCAGTACGGAGGATAAAACCGGCGAGGGTGATTCAGATACCGCTTCGCTGGGATTTGCCCTG
ACGGATCTCACTTTGGGCAATATGAAAAGTGACAGTCTGTTAAGGGGGGAAAGTCGTACTAAGGTGGCTT
CCGGTAATGCCAGCGGGACTTATTATGGCTATAGCCATGATAGCGATATCACCGGGTTTAACGCTAACGC
GTCTGCCAGCGGCGTTCAGTATGGCGCAACCGCCGCAGCAGGAAAGCAGGGCGTGCTGTATGGTAGTGTC
ACCGGGGATGTCACGGTTGTCACCGCTGAAACAAAACTTATCGGTGAGGTTTATAAAGGTAACCAAGGGC
GCTATGGATTTACCTCCGAAGCGGGCGCGGAAACGGCGGTCGTGAAGGGCGAGGGCGCGGTGAATTTTGA
TATCTATGGCGTTTTCGTATCGGAGGCTAAGCTGGGAGGGAACGGCAGGTGGCGTGGGGGCAGCTGCGGG
ATTTACAGGCTTCTGGGATACCACTGA