SecReT6
Protein ID: 385785917
SecReT6 ID601
T6SS typei3
Gene symbolvgrG1
Locus tagEJP617_04580
StrainErwinia sp. Ejp617
Repliconchromosome [GenBank: NC_017445] [Browse all T6SS(s) in this replicon]
Location [Strand]503752..505713 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDE3DET6
KEGG IDerj:EJP617_04580
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-70, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 1.90E-25, Aligned region: 365..458
Protein Sequence: 653 a.a.     [Download]
>gi|385785917|ref|YP_005817026.1| Rhs element Vgr protein [Erwinia sp. Ejp617]
MFDRITVQLPMDGLLFWRMSGREALSQSFELSVQLLSTDARIERRALLGQPITVCIPTQGIMSTRYLNGK
ITKVSVSSQQLSGTRYAVYTLVMEPDLWPLKRDKNLRIFQGQTVPQIVKTLLDEYNVALEDRLTGSYRSW
EYCVQYQESSFNFISRLMELEGIYYYFRHEADGHRLVLMDAEQQHQPFSGYEAIPWHATPSGGITSAEGI
SGWEFADAVTPGIYSIDDYDFRKPNAWMLQARQNPASPQPGAIDVYDWPGHFVDHDHGEFYVKIRQQVWQ
VEHQQISATGTALGLAPGYTFAVLKAPFISDNGEYLTTEACYDFEENSYASGGDSSSRHNISVQVIPSDI
TFRAQPDTPWPRTHGPQTAKVVGPKGESIWTDKYGRIKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYGG
VQIPRVGDEVVVDFINGDPDRPIVTGRVYNEASMPPWALPAAATQMGFMSRSKDGTPDNANALRFEDKAG
HEQIWLHAEKNMDTEVEHCETHDVGVDRHKTVGRDEKNIVKRNMLTDVGMHATSHTAEKHIINVGEDQAV
LTMDKQGNVLLEATASIRLKVKNNYILITPSAIEIQVAEGDLMAESEKGALLKGNELTLLGGGTDAELSA
SDTVSITGTNATDIKGALVKVNS
 
Nucleotide Sequence: 1962 bp     [Download]
>gi|385785459|ref|NC_017445.1|:c505713-503752 Erwinia sp. Ejp617 chromosome, complete genome
ATGTTTGACCGTATCACCGTACAGCTGCCGATGGACGGCCTGCTGTTCTGGCGCATGAGCGGGCGCGAAG
CGCTGTCACAGTCATTTGAACTGAGCGTTCAGCTGTTAAGCACCGATGCGCGCATCGAGCGCAGGGCGCT
GCTCGGCCAGCCGATCACCGTTTGCATTCCCACCCAGGGCATAATGAGCACGCGCTATCTGAACGGTAAA
ATCACCAAAGTCTCGGTCAGCAGCCAGCAGCTGAGCGGCACGCGCTATGCGGTGTATACCCTGGTGATGG
AGCCGGACCTGTGGCCGCTGAAGCGAGATAAAAACCTGCGCATTTTCCAGGGGCAGACGGTGCCGCAGAT
CGTCAAAACCCTGCTGGATGAGTACAACGTGGCGCTGGAAGATCGGCTGACCGGCAGCTACCGCAGCTGG
GAGTACTGCGTGCAGTACCAGGAGAGCAGCTTTAACTTTATCAGCCGCCTGATGGAGCTGGAAGGGATCT
ACTACTACTTCCGCCACGAGGCGGACGGGCACAGGCTGGTGCTGATGGACGCGGAGCAGCAGCACCAGCC
GTTCAGCGGCTATGAAGCGATCCCCTGGCACGCCACGCCATCCGGTGGCATTACCAGCGCAGAAGGTATC
AGCGGCTGGGAGTTTGCCGATGCGGTCACACCGGGTATCTACAGCATCGACGACTACGACTTCCGCAAGC
CGAACGCGTGGATGCTGCAGGCGCGGCAGAATCCGGCGTCGCCGCAGCCGGGTGCCATCGACGTCTACGA
CTGGCCTGGCCACTTTGTTGACCACGATCACGGTGAGTTCTACGTGAAAATCCGCCAGCAAGTGTGGCAG
GTGGAGCATCAGCAGATTAGCGCCACAGGCACCGCACTCGGCCTGGCACCGGGTTACACCTTTGCGGTGT
TGAAAGCGCCCTTTATCAGTGATAACGGTGAATATCTGACCACCGAAGCCTGCTATGACTTTGAGGAAAA
CAGCTACGCCAGCGGCGGCGATAGCAGCAGCAGGCACAATATCTCTGTTCAGGTGATCCCTTCGGATATC
ACCTTCCGCGCACAGCCGGACACGCCGTGGCCGCGCACCCACGGGCCGCAGACGGCGAAGGTGGTCGGGC
CAAAAGGGGAGTCGATCTGGACCGATAAATATGGCCGCATCAAAGTGAAATTTCACTGGGACAGGCTGGC
GAAGGGCGACGATACCAGCTCGTGCTGGGTGCGCGTCTCCAGCGCCTGGGCGGGCCAGGGCTACGGTGGG
GTGCAGATCCCGCGCGTGGGCGACGAGGTGGTGGTCGACTTTATCAACGGCGATCCGGACCGGCCGATCG
TCACCGGGCGCGTGTACAACGAGGCGAGCATGCCGCCGTGGGCGCTGCCTGCCGCCGCTACGCAGATGGG
CTTTATGAGCCGTTCGAAGGACGGTACGCCGGACAACGCCAACGCGCTGCGCTTTGAGGATAAAGCGGGT
CATGAACAGATCTGGCTGCATGCGGAAAAAAACATGGATACCGAGGTTGAACATTGCGAAACCCATGATG
TCGGCGTCGATCGTCATAAAACCGTTGGCCGCGACGAGAAAAACATCGTTAAACGCAACATGCTGACTGA
CGTTGGTATGCATGCAACCAGCCATACCGCAGAGAAACATATCATCAACGTCGGTGAGGATCAGGCCGTT
CTGACCATGGATAAGCAGGGTAATGTGCTGCTTGAAGCCACTGCCAGCATCAGGCTGAAGGTGAAAAATA
ATTACATTCTGATCACCCCATCAGCGATCGAAATACAGGTGGCGGAAGGGGATCTGATGGCGGAAAGCGA
AAAGGGAGCCTTATTGAAAGGCAACGAGCTTACCCTGCTGGGCGGAGGAACCGATGCGGAACTGAGCGCC
AGTGACACCGTCAGTATTACCGGAACCAACGCCACCGATATCAAAGGCGCGCTGGTCAAAGTAAACAGCT
AA