SecReT6
Protein ID: 385785922
SecReT6 ID601
T6SS typei3
Gene symbol-
Locus tagEJP617_04630
StrainErwinia sp. Ejp617
Repliconchromosome [GenBank: NC_017445] [Browse all T6SS(s) in this replicon]
Location [Strand]511036..512094 [-]
Producthypothetical protein
NoteTssG
UniProt IDE3DEU1
KEGG IDerj:EJP617_04630
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-105, Aligned region: 28..332
Protein Sequence: 352 a.a.     [Download]
>gi|385785922|ref|YP_005817031.1| hypothetical protein EJP617_04630 [Erwinia sp. Ejp617]
MTQQPAAQAEKIHRLHRLSPDFWAALCATPWRYDLFQLLRRLDAQGGHRYPLGRALLPRHEPLRIGQRPS
LAFAPAAIAGVTPRENSALHDVSIYSFGLFGPNGPLPVHLTEYARERSDHHQDNSLSAFADLFHHRLTLL
FYRAWADAQPTVALDRAEKRQFERWLASLIGMGQPGQLKQGSLSPHSRLALAGHLTRQARDAEGLQKILS
HYFQVQVRLVENVPHWQPVDRRDRASLGGGRRKPRLGVSAFLGVAVRDVQHKLRLDLGPLPMVSYQRFLP
GEPWAEQLRDWVRQYLGIEFLWEVRLILDAADVQGISLGGASRLGYSSWLGQPAVPQHRSDLTFSPEPQE
SV
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|385785459|ref|NC_017445.1|:c512094-511036 Erwinia sp. Ejp617 chromosome, complete genome
ATGACACAGCAGCCCGCCGCGCAGGCAGAGAAAATTCACCGCCTGCATCGCCTGTCGCCGGACTTCTGGG
CGGCGCTGTGCGCCACGCCGTGGCGCTATGACCTGTTCCAGCTGCTGCGGCGGCTGGATGCGCAGGGCGG
TCACCGCTATCCGCTGGGGCGTGCGCTGCTGCCGCGCCACGAACCGCTGCGCATCGGCCAGCGGCCGTCG
CTGGCCTTTGCCCCGGCGGCCATCGCCGGCGTCACGCCGCGTGAAAACAGTGCGCTGCACGATGTCTCGA
TCTACAGCTTCGGCCTGTTTGGCCCCAACGGGCCGCTGCCTGTCCATCTGACGGAATATGCGCGTGAGCG
CAGCGACCACCACCAGGACAACAGCCTGAGCGCCTTTGCCGATCTGTTCCACCACCGCCTGACGCTGCTG
TTTTACCGCGCCTGGGCCGATGCGCAGCCCACGGTGGCGCTGGATCGGGCGGAAAAACGCCAGTTTGAGC
GCTGGCTCGCCAGCCTGATCGGCATGGGCCAGCCGGGGCAGCTAAAGCAGGGCAGCCTTAGCCCGCATTC
ACGCCTGGCGCTGGCCGGGCACCTTACCCGCCAGGCACGCGATGCCGAGGGATTACAAAAAATCCTCAGT
CATTACTTTCAGGTGCAGGTGCGGCTGGTGGAAAACGTGCCTCACTGGCAGCCGGTTGACCGTCGCGACC
GCGCCAGCCTGGGGGGCGGACGGCGCAAACCGCGACTCGGGGTTTCTGCGTTTCTCGGCGTGGCGGTGCG
CGATGTGCAGCACAAGTTACGTCTGGATCTGGGACCGCTGCCAATGGTCAGCTACCAGCGTTTTCTGCCC
GGCGAACCCTGGGCGGAGCAGCTGCGCGACTGGGTGCGTCAGTACCTGGGCATTGAGTTTCTCTGGGAGG
TGCGGCTGATCCTTGACGCCGCCGATGTGCAGGGCATCTCCCTCGGCGGCGCATCCCGGCTGGGGTACAG
CAGCTGGCTGGGCCAGCCCGCCGTCCCACAGCACCGCAGCGATCTCACCTTTAGTCCGGAGCCGCAGGAA
AGTGTTTAA