SecReT6
Protein ID: 385785924
SecReT6 ID601
T6SS typei3
Gene symbol-
Locus tagEJP617_04650
StrainErwinia sp. Ejp617
Repliconchromosome [GenBank: NC_017445] [Browse all T6SS(s) in this replicon]
Location [Strand]513984..514550 [-]
Producthypothetical protein
NoteTssE
UniProt IDE3DEU3
KEGG IDerj:EJP617_04650
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.60E-19, Aligned region: 57..167
Protein Sequence: 188 a.a.     [Download]
>gi|385785924|ref|YP_005817033.1| hypothetical protein EJP617_04650 [Erwinia sp. Ejp617]
MSQHSDEGHKLLHGGYRQRRQQEGLNIREKMQPSLLDRLTDNAPDNPREAAHSTLISHSTLRRNVLRDLQ
WLFNTINNEAQQDLSPFPHVQRSTLNFGISPLAGQRMSDIEWQDIQRKLSAAILNFEPRILPAGLQVRCV
SDTSSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDVDLEIGHFALRDIG
 
Nucleotide Sequence: 567 bp     [Download]
>gi|385785459|ref|NC_017445.1|:c514550-513984 Erwinia sp. Ejp617 chromosome, complete genome
ATGAGCCAGCACAGCGATGAAGGGCATAAGCTGCTGCACGGCGGTTACCGCCAGCGCCGCCAGCAGGAAG
GGCTGAACATCCGCGAAAAAATGCAGCCATCGCTGCTCGATCGTCTGACCGACAACGCGCCGGATAATCC
GCGTGAAGCGGCGCACAGCACGCTGATCTCGCACAGTACGCTGCGGCGCAACGTGCTGCGCGACCTGCAG
TGGCTGTTTAATACCATTAACAATGAAGCGCAGCAGGATCTGTCACCATTCCCGCATGTACAGCGTTCGA
CGCTGAACTTTGGCATTTCGCCGCTGGCGGGGCAGCGCATGTCGGATATTGAATGGCAGGATATCCAGCG
CAAGCTAAGCGCGGCGATCCTCAACTTCGAACCGCGCATTCTGCCCGCCGGGTTACAGGTGCGCTGCGTG
TCCGACACCAGCTCGCTTGACCTGCACAACGTGCTGTCGATCGAGATCAAGGGCCGCCTGTGGTGCGTGC
CGTATCCGCTGGAATTTCTGTTTCGTACCGATGTGGATCTGGAAATCGGCCACTTTGCGCTGCGCGATAT
CGGTTAA