SecReT6
Protein ID: 385785925
SecReT6 ID601
T6SS typei3
Gene symbol-
Locus tagEJP617_04660
StrainErwinia sp. Ejp617
Repliconchromosome [GenBank: NC_017445] [Browse all T6SS(s) in this replicon]
Location [Strand]514547..515368 [-]
Producthypothetical protein
NoteTagJ
UniProt IDE3DEU4
KEGG IDerj:EJP617_04660
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.30E-39, Aligned region: 143..266
Protein Sequence: 273 a.a.     [Download]
>gi|385785925|ref|YP_005817034.1| hypothetical protein EJP617_04660 [Erwinia sp. Ejp617]
MHSLQHLMDGQSLAETLARIESQIKRQPADADLRASFVQLLCLAGNWSRAQTQLKSWLALKPQAQPTVQL
LDQAINAERQRAAVFAGEASPRMPGAAWNWAEQLLAALAADAAGDRAQAQRLRGCALEAAQLNPGQLTHQ
NQQQTFDWLTDGDGRLGPVCELIANGQYSWLPFSAISEIRFQAPVSVTDLVWRHTLVRMVDGSEQVCQIP
VRYPFVEQADDRYRLATLTEWQPLPGDDQQFSGHGQKCWFSADAEFPLLGMEMLAFSDAEPAL
 
Nucleotide Sequence: 822 bp     [Download]
>gi|385785459|ref|NC_017445.1|:c515368-514547 Erwinia sp. Ejp617 chromosome, complete genome
ATGCATTCGTTACAACATCTGATGGACGGCCAGTCGCTGGCTGAAACTCTGGCGAGAATCGAAAGCCAGA
TAAAACGCCAGCCTGCCGATGCCGATCTGCGCGCCAGCTTTGTCCAGCTGCTGTGCCTGGCGGGCAACTG
GAGCCGGGCGCAGACGCAGCTAAAATCCTGGCTGGCGCTGAAACCGCAGGCACAGCCAACGGTCCAGCTG
CTGGATCAGGCGATTAACGCTGAACGCCAGCGTGCGGCGGTATTTGCCGGTGAAGCATCACCGCGTATGC
CGGGCGCGGCATGGAATTGGGCAGAGCAGCTGCTGGCCGCGCTGGCGGCCGATGCCGCAGGCGATCGTGC
TCAGGCACAACGGCTGCGCGGCTGCGCTTTAGAAGCGGCGCAGCTGAATCCCGGGCAGTTAACGCACCAG
AATCAGCAGCAAACCTTTGACTGGCTCACAGACGGTGACGGGCGGCTCGGCCCGGTGTGCGAACTGATTG
CCAACGGACAGTACAGCTGGCTGCCGTTCAGCGCCATCAGCGAAATACGCTTTCAGGCTCCGGTCAGCGT
CACCGACCTGGTATGGCGGCATACGCTGGTCAGAATGGTGGATGGCAGCGAGCAGGTGTGCCAGATACCG
GTACGCTATCCGTTTGTCGAACAGGCCGACGACCGCTACCGGCTGGCCACGCTGACCGAATGGCAACCGC
TGCCGGGCGATGACCAGCAGTTCAGCGGCCACGGGCAGAAATGCTGGTTCAGCGCCGACGCCGAATTCCC
GCTGCTGGGCATGGAGATGCTGGCGTTTAGCGATGCAGAGCCAGCCTTATGA