SecReT6
Protein ID: 385785928
SecReT6 ID601
T6SS typei3
Gene symbol-
Locus tagEJP617_04690
StrainErwinia sp. Ejp617
Repliconchromosome [GenBank: NC_017445] [Browse all T6SS(s) in this replicon]
Location [Strand]517155..518981 [-]
ProductType VI secretion system, FHA domain-containing protein
NoteFha
UniProt IDE3DEU7
KEGG IDerj:EJP617_04690
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 6.10E-08, Aligned region: 27..94
UreE_N [PF02814], Evalue: 0.0023, Aligned region: 30..49
UreE_N [PF02814], Evalue: 0.0023, Aligned region: 78..99
UreE_N [PF02814], Evalue: 0.0023, Aligned region: 186..202
Protein Sequence: 608 a.a.     [Download]
>gi|385785928|ref|YP_005817037.1| Type VI secretion system, FHA domain-containing protein [Erwinia sp. Ejp617]
MRFTIITSKQGQQPPQGSCDFLPPGGTIGRGADNNLVLPDDDRTISRLQAIVHISATGECHITNRGNVTR
VHLNDIPLERGRQVELQDGDIIGIDDYRLQVSELSAAAQPLSQPVPAPAAPRPQPVAPAAAAAPAAIPSE
IWDSLAQEFSISDNLSSRSKAKPQSQANPLTAPAAAERNPADPLAQLAQNSDPLNLERRDRTPDRLFNQD
PLFKQDSIFDDSTPSTLFQPPGAKSSVTHGARQDEQDPLALFGAGAAPQVDRDDPLGLMMGSAVPLTPPE
DKPQQTSEQPIIPPTPEAVPPVTGEKTSSSADELPLPDSDFSLFGDDKTQQSDEANSPLFDVPPPGPAAA
QPTASSASGDYGGITLPTPQARARSNTPPPKGRLSIDPVANSTAHSSGSSGEVLDGDLMAALVGGMGLQD
LQPTPRFDQHAMQELGQMLSMFSQGTVALLSSRSILKRGVKAEMTVILDEANNPFKLLPSGKSVLMQMFG
SRMPGFMPPKQSVRDALVDLQAHQLGMIAGIRALIASMLQSFNPQQLEEEARQEGAISRLSLPGSRKAAL
WDHFSKRYSETAGEIEDDFHTLFGEAFLHAYDMEVNQYKDSQIRSEER
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|385785459|ref|NC_017445.1|:c518981-517155 Erwinia sp. Ejp617 chromosome, complete genome
ATGCGATTTACAATTATAACGAGCAAACAGGGCCAGCAGCCGCCGCAGGGCAGCTGCGACTTTCTGCCGC
CCGGCGGCACCATTGGTCGTGGTGCTGATAACAACCTGGTGTTGCCGGATGATGACCGCACCATTTCACG
CCTGCAGGCTATCGTGCATATCAGCGCCACGGGCGAGTGCCATATCACCAATCGTGGCAACGTGACGCGC
GTCCACCTGAATGATATTCCGCTGGAGCGTGGCCGCCAGGTCGAGCTGCAGGATGGCGATATTATCGGCA
TTGACGACTATCGCCTGCAGGTCAGCGAACTGAGCGCAGCCGCGCAGCCGCTAAGCCAGCCGGTGCCAGC
GCCCGCAGCGCCGCGCCCGCAGCCGGTCGCCCCGGCGGCAGCCGCTGCGCCAGCGGCTATCCCCAGCGAG
ATCTGGGACAGCCTGGCGCAGGAGTTCTCGATCTCCGATAACCTCTCCAGCCGCAGCAAAGCCAAACCGC
AAAGCCAGGCTAACCCGCTGACCGCCCCGGCCGCCGCCGAGCGTAATCCGGCCGATCCGCTGGCGCAGCT
GGCGCAGAACAGCGATCCGCTAAACCTCGAACGCCGCGATCGCACCCCCGACCGCCTGTTTAACCAGGAT
CCGCTGTTTAAACAGGACAGCATCTTTGATGACAGCACCCCCAGCACGCTGTTCCAGCCGCCGGGGGCAA
AAAGCAGCGTTACGCACGGCGCACGCCAGGATGAGCAGGACCCGCTGGCGCTGTTCGGCGCAGGCGCAGC
GCCACAGGTCGATCGCGACGACCCGCTCGGCCTGATGATGGGCAGCGCGGTGCCGCTGACGCCGCCAGAG
GATAAGCCGCAGCAGACCTCAGAGCAGCCGATCATCCCGCCAACGCCAGAAGCCGTGCCGCCTGTCACCG
GAGAAAAAACATCATCTTCGGCGGATGAGCTGCCGCTGCCGGACAGCGATTTCAGCCTGTTTGGCGACGA
CAAAACGCAGCAGTCAGACGAGGCCAACTCGCCGCTGTTTGACGTGCCGCCGCCTGGCCCGGCCGCTGCT
CAGCCGACGGCGTCCTCCGCCAGCGGCGACTACGGCGGTATTACGCTGCCGACCCCTCAGGCGCGCGCGC
GTAGCAACACTCCACCACCGAAAGGTCGGCTGAGTATCGACCCGGTGGCCAACAGCACGGCGCACAGCAG
CGGCAGCAGCGGTGAAGTGCTGGACGGCGATCTGATGGCGGCGCTGGTCGGCGGTATGGGCCTGCAGGAT
CTGCAACCCACACCGCGCTTTGACCAGCACGCGATGCAGGAGCTGGGGCAGATGCTCAGCATGTTCTCGC
AGGGCACGGTGGCGCTGCTCTCTTCGCGTTCGATCCTTAAGCGCGGCGTAAAAGCCGAAATGACGGTGAT
CCTCGACGAGGCCAATAACCCGTTTAAGCTGCTGCCGTCCGGCAAATCGGTACTGATGCAGATGTTTGGC
AGCCGCATGCCGGGCTTTATGCCGCCAAAACAGTCGGTGCGCGATGCGCTGGTTGATTTGCAGGCGCACC
AGCTGGGGATGATCGCCGGCATCCGTGCGCTGATTGCCTCCATGCTGCAATCATTTAATCCGCAACAGTT
GGAGGAGGAAGCGCGCCAGGAAGGTGCCATCTCGCGCCTGTCGCTGCCGGGCAGCCGCAAAGCCGCGCTG
TGGGACCACTTCAGCAAACGCTATAGCGAAACCGCCGGCGAGATTGAAGACGACTTCCACACCCTGTTTG
GTGAAGCCTTCCTCCATGCTTACGATATGGAAGTCAACCAGTACAAAGACTCACAGATCAGATCGGAAGA
AAGATGA