SecReT6
Protein ID: 385785934
SecReT6 ID601
T6SS typei3
Gene symbolhcp
Locus tagEJP617_04750
StrainErwinia sp. Ejp617
Repliconchromosome [GenBank: NC_017445] [Browse all T6SS(s) in this replicon]
Location [Strand]523718..524200 [-]
Productsecretion apparatus virulence factor
NoteTssD
UniProt IDE3DEV3
KEGG IDerj:EJP617_04750
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.00E-39, Aligned region: 6..135
Protein Sequence: 160 a.a.     [Download]
>gi|385785934|ref|YP_005817043.1| secretion apparatus virulence factor [Erwinia sp. Ejp617]
MANDMYLKVDGVTGESKDANHTGWIDVTSFSWGATQPGNMSVGGGGGAGKVNFSDLNINAKIDKAATALL
KNCASGKHIGKVEVSVCKAGGKQMEYIRITLEDVLVTNVSFSGGGSAETLGVTYAFQAAKVQQEYWEQST
TGGKGAGTKVGWNIKGNQEM
 
Nucleotide Sequence: 483 bp     [Download]
>gi|385785459|ref|NC_017445.1|:c524200-523718 Erwinia sp. Ejp617 chromosome, complete genome
ATGGCTAATGATATGTATTTGAAAGTGGACGGTGTAACCGGTGAATCTAAAGATGCTAACCACACCGGCT
GGATCGACGTGACTTCTTTCTCCTGGGGCGCTACCCAGCCGGGCAATATGTCGGTAGGCGGCGGCGGCGG
TGCCGGTAAAGTGAACTTTAGCGATCTGAACATCAATGCAAAAATCGATAAAGCGGCCACCGCACTGCTG
AAAAACTGCGCCAGCGGTAAGCACATAGGCAAAGTAGAAGTTTCCGTATGTAAAGCGGGCGGAAAACAGA
TGGAGTACATCCGTATTACTCTGGAAGACGTGCTGGTGACCAACGTGAGTTTCAGCGGTGGAGGCAGCGC
TGAGACTCTGGGCGTAACCTACGCATTCCAGGCTGCCAAAGTGCAACAGGAGTACTGGGAGCAGAGCACC
ACCGGTGGTAAAGGCGCAGGAACCAAGGTTGGGTGGAATATTAAAGGGAATCAAGAAATGTAA