SecReT6
Protein ID: 385785936
SecReT6 ID601
T6SS typei3
Gene symbol-
Locus tagEJP617_04770
StrainErwinia sp. Ejp617
Repliconchromosome [GenBank: NC_017445] [Browse all T6SS(s) in this replicon]
Location [Strand]524744..526243 [-]
Producthypothetical protein
NoteTssC
UniProt IDE3DEV5
KEGG IDerj:EJP617_04770
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.40E-196, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|385785936|ref|YP_005817045.1| hypothetical protein EJP617_04770 [Erwinia sp. Ejp617]
MSNPFQQSGDLQQQAYSEDAFSALLNKEFRPKSDQARAAVESAVKTLAQQALENSVTVSNDAYRTIQALI
AEIDDKLSQQVNQIIHHEDFQQLEGAWRGLSYLVNNTETDEMLKIRFMSISKQELGRTLKRYKGVSWDQS
PIFKKIYEEEYGQFGGEPFGCLVGDYYFDHGPQDVELLSEMARIGSAAHCPFITGTAPGVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEQTDGANHGNYTWTN
AAYAMAANINRSFKEFGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDFAAFIGAQSLQKPAEYHDADATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVQVQEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKSNEA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|385785459|ref|NC_017445.1|:c526243-524744 Erwinia sp. Ejp617 chromosome, complete genome
ATGAGCAACCCATTCCAACAGTCAGGCGATTTGCAGCAGCAGGCCTACAGCGAGGACGCGTTCAGCGCGC
TGCTGAATAAAGAGTTCCGCCCGAAAAGCGACCAGGCGCGCGCGGCGGTGGAAAGCGCGGTGAAAACCCT
TGCGCAGCAGGCGCTGGAAAATAGCGTTACCGTCTCCAACGATGCCTACCGCACCATCCAGGCGCTGATT
GCCGAGATCGACGACAAGCTTTCCCAGCAGGTCAACCAGATTATCCACCATGAAGACTTCCAGCAGCTGG
AAGGGGCGTGGCGCGGCCTGAGCTATCTGGTTAACAACACCGAAACCGACGAGATGCTGAAAATCCGCTT
TATGAGCATCTCTAAGCAGGAGCTGGGCCGCACCCTGAAGCGCTATAAGGGCGTCAGCTGGGATCAAAGC
CCGATCTTTAAGAAGATCTATGAGGAAGAGTACGGTCAGTTCGGCGGCGAACCCTTTGGCTGCCTGGTGG
GCGACTACTACTTCGATCACGGCCCGCAGGACGTGGAGCTGCTAAGCGAAATGGCGCGTATCGGCTCTGC
CGCCCACTGTCCGTTTATCACCGGCACCGCGCCGGGAGTGATGCAGATGGAGTCCTGGCAGGAGCTGGCC
AACCCGCGTGACCTGACCAAAATCTTCCAGAACACCGAATACGCCGCCTGGCGCAGTCTGCGCGAATCGG
AAGATGCGCGCTACCTCGGCTTGGTGATGCCGCGCTTCCTGTCGCGCCTGCCTTATGGCATCCGCACCAA
TCCGGTAGACAGCTTCGACTTTGAAGAGCAGACCGACGGTGCCAACCACGGCAACTACACCTGGACCAAC
GCTGCCTACGCGATGGCCGCCAATATCAACCGCTCGTTTAAAGAGTTTGGCTGGTGTACCTCGATCCGTG
GCGTTGAGTCCGGCGGGGCGGTGGAAAACCTGCCGTGCCACACCTTCCCGAGCGACGACGGCGGCGTGGA
CATGAAATGCCCGACCGAAATCGCCATCAGCGACCGGCGTGAAGCCGAGCTGGCGAAAAACGGCTTTATG
CCGCTGGTGCACCGCAAAAACTCCGACTTTGCCGCCTTTATTGGCGCGCAGTCGCTGCAAAAACCGGCGG
AATACCACGATGCTGATGCAACCGCTAACGCCCGGCTGGCGGCGCGGCTGCCGTATCTGTTCGCCTGCTG
CCGCTTTGCCCACTACCTGAAGTGCATCGTGCGCGACAAGATTGGCTCCTTCCGTGAGCGCGACGAGATG
GAGCGCTGGCTGAACGACTGGGTGATGAACTACGTTGACGGTGACCCGGCTAACTCCTCGCAGGAAACCA
AATCACGCAAGCCGCTGGCTGCCGCCGAGGTGCAGGTGCAGGAGATCGAAGATAACCCGGGCTACTACGC
GGCCAAGTTCTTCCTGCGTCCGCACTACCAGCTGGAAGGCCTTACCGTATCGCTGCGCCTGGTCTCTAAG
CTGCCGTCGCTGAAATCGAACGAGGCGTGA