SecReT6
Protein ID: 385785937
SecReT6 ID601
T6SS typei3
Gene symbol-
Locus tagEJP617_04780
StrainErwinia sp. Ejp617
Repliconchromosome [GenBank: NC_017445] [Browse all T6SS(s) in this replicon]
Location [Strand]526247..526783 [-]
Producthypothetical protein
NoteTssB
UniProt IDE3DEV6
KEGG IDerj:EJP617_04780
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.80E-59, Aligned region: 12..162
Protein Sequence: 178 a.a.     [Download]
>gi|385785937|ref|YP_005817046.1| hypothetical protein EJP617_04780 [Erwinia sp. Ejp617]
MAVSKSSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMSDLVGKPLEAQPGVDERKFLEIDVDN
FDERMKALKPRVAFQAENTLTGEGRLNIDLTFNSMEDFSPDAVARKVEPLNQLLDARTQLANLLTYMDGK
NGAEELIGKILQDPTLLQSLSHLPKADDKAADDHGNKE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|385785459|ref|NC_017445.1|:c526783-526247 Erwinia sp. Ejp617 chromosome, complete genome
ATGGCAGTCAGTAAATCCAGTGGGCAAAAATTCATTGCCCGTAACCGCGCGCCACGCGTGCAGATTGAGT
ACGACGTGGAAATCTATGGTGCGGAACGCAAAATCCAGCTGCCCTTCGTGATGGGCGTGATGTCCGACCT
GGTAGGCAAACCGCTGGAGGCGCAGCCGGGCGTCGATGAGCGTAAGTTCCTTGAAATCGACGTCGACAAC
TTCGACGAACGTATGAAGGCGCTCAAACCACGCGTGGCATTCCAGGCGGAAAACACCCTGACCGGAGAAG
GGCGTCTTAATATCGATCTGACCTTTAACAGCATGGAAGACTTCTCGCCGGATGCGGTGGCACGTAAAGT
CGAGCCACTCAATCAGCTGCTGGATGCCCGTACCCAGCTGGCTAACCTGCTGACCTATATGGATGGCAAG
AACGGTGCGGAAGAACTGATCGGCAAAATCCTGCAGGACCCGACGCTGCTGCAATCACTCAGCCATCTGC
CGAAAGCTGACGACAAGGCAGCCGACGACCACGGCAACAAGGAGTAA