SecReT6
Protein ID: 385785938
SecReT6 ID601
T6SS typei3
Gene symbol-
Locus tagEJP617_04790
StrainErwinia sp. Ejp617
Repliconchromosome [GenBank: NC_017445] [Browse all T6SS(s) in this replicon]
Location [Strand]526845..527852 [-]
ProductType VI secretion system-associated, ImpA protein
NoteTssA
UniProt IDE3DEV7
KEGG IDerj:EJP617_04790
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.90E-19, Aligned region: 52..111
Protein Sequence: 335 a.a.     [Download]
>gi|385785938|ref|YP_005817047.1| Type VI secretion system-associated, ImpA protein [Erwinia sp. Ejp617]
MNLEALLAPVTPDRPCGDNLEYDADYMAMDQASAGKAEQQFGDTIIPAEPADWNKVERLALDLLGRSKDL
RVMLALTRAWTQLKGLSGYADGLQLIQQALLLYWQPLWPSLEEEGVEDPFYRLNALAALGDKSALTGALR
QAPLLRYASDEISLRDACALLDGSKTECSGYPGGRARLQDELARGGQPGIEAVIKISERLLTIRETLTEQ
LGATALPEMEQLLKTINTVAAACQATDLNTLIPQTETAASSATPPPATQLHADWRSVQLGSRSDAQLMLE
KVKQYFSQHEPSHPAPLMIERVQRMIELDFMDIIRDLAPDGVHQLETIFGRRDHS
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|385785459|ref|NC_017445.1|:c527852-526845 Erwinia sp. Ejp617 chromosome, complete genome
ATGAATCTTGAAGCGCTGCTGGCCCCGGTCACGCCTGACCGCCCCTGTGGGGATAACCTTGAATATGACG
CCGACTACATGGCGATGGACCAGGCCAGCGCCGGTAAAGCCGAACAGCAGTTTGGCGATACCATTATCCC
GGCGGAACCGGCGGACTGGAACAAAGTCGAGCGGCTGGCGCTGGATCTGCTGGGGCGCAGCAAAGATCTG
CGCGTGATGCTGGCGCTGACCCGCGCCTGGACCCAGCTCAAAGGGTTAAGTGGTTACGCCGACGGCCTGC
AGCTGATCCAGCAGGCGCTGCTGCTTTACTGGCAGCCGCTGTGGCCGTCACTGGAAGAAGAAGGCGTAGA
GGATCCGTTTTATCGCCTTAACGCGCTGGCGGCGCTGGGGGACAAATCGGCGCTGACCGGCGCGTTGCGC
CAGGCTCCGCTGCTGCGCTATGCCAGCGATGAAATCAGCCTGCGCGACGCCTGTGCGCTGCTTGACGGCA
GCAAAACCGAATGCTCCGGCTATCCCGGTGGCCGCGCCCGCCTGCAGGATGAGCTGGCGCGTGGAGGGCA
GCCCGGTATTGAAGCGGTCATTAAGATAAGTGAGCGGTTACTGACAATTCGCGAAACCCTGACCGAACAG
CTGGGCGCTACGGCCCTGCCGGAAATGGAGCAGCTGCTGAAAACCATTAATACCGTGGCTGCCGCCTGTC
AGGCCACTGACCTCAACACCCTGATCCCCCAGACGGAAACCGCCGCCAGCAGCGCTACGCCGCCGCCCGC
CACCCAGCTGCACGCCGACTGGCGCAGCGTGCAGCTGGGTTCGCGCAGCGATGCGCAGCTGATGCTGGAA
AAGGTCAAACAGTATTTCAGCCAGCACGAGCCAAGCCATCCCGCGCCGCTGATGATCGAGCGGGTACAAC
GCATGATAGAGCTGGACTTTATGGACATTATCCGCGACCTCGCCCCGGACGGCGTACACCAGCTGGAGAC
GATTTTCGGGCGTCGCGACCACTCATAG