SecReT6
Protein ID: 385785941
SecReT6 ID601
T6SS typei3
Gene symbolvasF
Locus tagEJP617_04820
StrainErwinia sp. Ejp617
Repliconchromosome [GenBank: NC_017445] [Browse all T6SS(s) in this replicon]
Location [Strand]532233..533474 [-]
ProductOmpA family protein
NoteTssL
UniProt IDE3DEW0
KEGG IDerj:EJP617_04820
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.00E-71, Aligned region: 21..226
DUF2077 [PF09850], Evalue: 2.00E-71, Aligned region: 353..390
OmpA [PF00691], Evalue: 5.60E-16, Aligned region: 291..389
Protein Sequence: 413 a.a.     [Download]
>gi|385785941|ref|YP_005817050.1| OmpA family protein [Erwinia sp. Ejp617]
MKQERHSEAAQAGMGGANSHNPLVAAANPLLNAIPQIRHSISHPDPAGLRQRLVDEIRQFEMNCQRAGLP
WEVIIGARYCLCTALDEAAALTPWGGRGVWPGNGLLVTFHNETWGGEKFFQLLARLSQTPREQIALLELI
NFCLQLGFEGRYRVMDNGRSQLETIRQRLLQMIRSVRGGYAPPLSAHPEDHPVTRQLWRPVVPLWACTAV
VGFLACLLYILLNWRLGDYTSPVLASIYQTTLPEVSIHNPAPPQPAAVNLKTFLKPEIEQGLVVVRDEAD
RSVVTLKGDGLFTSASTDVRGRYAEVLDRVAAAMNNVSGRILVVGYSDNVPIRSARFASNYELSLARAQS
VSEQLQQHLTQPQRVKAEGRGDSNPLAPNNSAGNRARNRRVEITLLVSPGSTRAELNDMAQGN
 
Nucleotide Sequence: 1242 bp     [Download]
>gi|385785459|ref|NC_017445.1|:c533474-532233 Erwinia sp. Ejp617 chromosome, complete genome
ATGAAACAGGAAAGACATTCTGAAGCCGCCCAGGCGGGTATGGGCGGTGCCAACAGCCATAATCCTCTGG
TGGCCGCAGCGAACCCGCTGCTGAACGCCATTCCACAGATTCGCCATTCGATTTCTCATCCCGATCCGGC
CGGTTTACGCCAGCGGCTGGTCGATGAGATCCGCCAGTTTGAAATGAACTGTCAGCGCGCCGGGCTGCCG
TGGGAAGTGATCATTGGCGCGCGTTACTGTCTGTGTACCGCGCTGGACGAAGCGGCGGCGCTTACCCCGT
GGGGCGGGCGCGGCGTCTGGCCCGGCAACGGGCTGCTGGTCACCTTTCACAACGAAACCTGGGGCGGCGA
GAAGTTTTTCCAGCTGCTGGCGCGTCTGTCGCAGACGCCACGCGAACAAATCGCCCTGCTGGAGCTGATT
AACTTCTGCCTGCAGCTGGGCTTTGAGGGGCGCTACCGGGTGATGGACAACGGGCGATCCCAGCTGGAAA
CCATCAGGCAGCGCCTGTTGCAGATGATCCGCTCGGTGCGCGGTGGCTATGCGCCGCCGCTGTCGGCACA
TCCGGAAGATCACCCGGTGACGCGTCAACTGTGGCGTCCGGTGGTGCCGCTGTGGGCCTGTACCGCTGTG
GTGGGCTTCCTCGCCTGCCTGCTCTATATTCTGCTCAACTGGCGGCTGGGCGACTATACCAGCCCGGTGC
TGGCCTCAATTTACCAGACGACCCTACCCGAAGTCAGTATTCACAATCCCGCGCCGCCGCAGCCAGCAGC
GGTTAACCTGAAAACCTTCCTGAAACCGGAAATTGAACAGGGGCTGGTGGTGGTGCGCGATGAAGCCGAC
CGCAGCGTGGTGACGCTGAAAGGTGACGGCCTGTTCACCTCCGCATCGACCGACGTGCGTGGCCGCTACG
CCGAGGTGCTGGATCGCGTTGCCGCCGCCATGAACAACGTCAGCGGCCGCATCCTGGTGGTGGGCTACAG
TGATAACGTACCGATCCGCAGCGCACGCTTTGCCTCCAACTACGAGCTTTCCCTGGCGCGTGCGCAGTCG
GTCAGCGAACAATTGCAGCAGCATCTGACGCAGCCGCAGCGGGTCAAAGCGGAAGGGCGTGGCGATAGCA
ATCCGCTTGCGCCGAATAACAGCGCCGGCAATCGCGCCCGCAACCGACGCGTAGAAATCACGCTGCTGGT
TTCGCCGGGCAGTACCCGGGCCGAGCTGAACGACATGGCGCAAGGAAATTAA