SecReT6
Protein ID: 385785942
SecReT6 ID601
T6SS typei3
Gene symbol-
Locus tagEJP617_04830
StrainErwinia sp. Ejp617
Repliconchromosome [GenBank: NC_017445] [Browse all T6SS(s) in this replicon]
Location [Strand]533492..534835 [-]
Producthypothetical protein
NoteTssK
UniProt IDE3DEW1
KEGG IDerj:EJP617_04830
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.00E-140, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|385785942|ref|YP_005817051.1| hypothetical protein EJP617_04830 [Erwinia sp. Ejp617]
MSKAEKVVWTEGMFLRPHHFQQSENYLQSTLRDWGQAQRPWLWGLHDIEFDKSMLRQGKVALLSASGLLP
DGTAFAFYNGHDAPPPLFIPDNLAQVKVVLALPARRGGREEVIFSEAGDSLARFISFEREVDDFNAMAVG
QAAVQFGRLRLRLMLESELSAEWTAIGVARISEKRSDHQLRLDASYIPPMLNAINQSQLMEYIGDIHALL
AQRSQQIGQRLQQPGRFNTADMVDFMLLTLINQQLGHISHVKSLPLVHPETLFHGWLVFAAELTSWMPSR
TPDAALPVYQHDDLAGCFSQLLLLLRQGLSQVMEENALQLPLTERSHGLNVATVPESSMVREFGFVLAVR
ANVPAEAIQTHFPAQMKVAPVTKIRDLVQLQLPGIMLRAMPAAPPQIPWHAGYNYFQLDKGSELWQEMEK
SGTFALHLAGEFPGLEMEFWAIRSHSV
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|385785459|ref|NC_017445.1|:c534835-533492 Erwinia sp. Ejp617 chromosome, complete genome
ATGAGCAAAGCAGAAAAAGTAGTCTGGACCGAAGGAATGTTTCTGCGTCCGCATCATTTTCAGCAGAGCG
AAAACTACCTGCAAAGCACGCTGCGCGACTGGGGACAGGCGCAGCGTCCGTGGCTTTGGGGTCTGCACGA
CATTGAATTTGATAAATCGATGCTGCGCCAGGGCAAAGTCGCGCTGCTCTCGGCCAGCGGCCTGCTGCCG
GACGGCACGGCGTTTGCCTTCTACAATGGTCACGACGCGCCACCGCCGCTCTTTATCCCCGATAACCTGG
CCCAGGTCAAAGTGGTACTGGCGCTGCCGGCACGGCGCGGCGGGCGTGAAGAGGTGATCTTCAGCGAGGC
TGGCGATTCGCTGGCGCGCTTTATCAGCTTCGAGCGGGAAGTGGATGATTTTAACGCCATGGCGGTCGGT
CAGGCGGCGGTACAGTTTGGCCGTTTACGTCTGCGGCTGATGCTGGAAAGCGAACTGAGCGCCGAATGGA
CCGCCATCGGCGTGGCGCGCATCAGTGAAAAGCGCAGTGACCACCAACTGCGTCTGGACGCCAGCTATAT
CCCGCCGATGCTCAATGCCATCAACCAGTCGCAGCTGATGGAATACATAGGCGATATCCACGCCCTGCTG
GCGCAGCGCAGCCAGCAGATCGGCCAGCGCTTGCAGCAGCCTGGGCGCTTTAATACCGCCGACATGGTCG
ACTTTATGCTGCTGACGCTGATCAACCAGCAGCTGGGGCATATCAGCCATGTGAAAAGTCTGCCGCTTGT
CCATCCTGAAACGTTGTTTCACGGCTGGCTGGTGTTCGCGGCTGAACTGACCAGCTGGATGCCGTCGCGC
ACCCCGGACGCGGCGCTGCCGGTTTACCAACATGACGATCTGGCTGGCTGCTTTAGCCAGCTGCTGCTGC
TGCTACGTCAGGGGCTGTCGCAGGTGATGGAAGAGAATGCGCTGCAGCTGCCGCTGACCGAGCGCTCACA
CGGCCTGAACGTGGCTACGGTGCCGGAGTCCTCGATGGTGCGTGAGTTTGGCTTTGTGCTGGCGGTGCGC
GCCAACGTCCCGGCCGAAGCGATACAAACCCACTTCCCGGCGCAGATGAAAGTGGCTCCCGTCACCAAAA
TCCGCGATCTGGTCCAGCTGCAGCTGCCCGGCATTATGCTGCGGGCAATGCCAGCCGCTCCACCACAAAT
TCCGTGGCACGCGGGCTATAACTATTTTCAGCTCGATAAGGGCAGCGAACTGTGGCAGGAGATGGAAAAG
TCCGGCACCTTCGCGCTACACCTGGCCGGCGAGTTCCCGGGGCTGGAGATGGAGTTCTGGGCAATCCGCA
GTCACTCAGTCTGA