SecReT6
Protein ID: 385785943
SecReT6 ID601
T6SS typei3
Gene symbol-
Locus tagEJP617_04840
StrainErwinia sp. Ejp617
Repliconchromosome [GenBank: NC_017445] [Browse all T6SS(s) in this replicon]
Location [Strand]534855..535367 [-]
ProductType VI secretion system, lipoprotein
NoteTssJ
UniProt IDE3DEW2
KEGG IDerj:EJP617_04840
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.30E-30, Aligned region: 20..141
Protein Sequence: 170 a.a.     [Download]
>gi|385785943|ref|YP_005817052.1| Type VI secretion system, lipoprotein [Erwinia sp. Ejp617]
MHRLSISRLITQAFLLAAFTLLAGCVSSSRSVPAQYSLVFQAHPQINDSAPLKVRVLLLKSDADFMAADF
YSLQTNPQGVLGQNLLNSEQFFLMPGQTDKKRAGQSSPEARYIGIMAEYQTLDGKKWRVSLPVPLPAERH
FYQIWQGDADNLRADVIADINGVRVINARD
 
Nucleotide Sequence: 513 bp     [Download]
>gi|385785459|ref|NC_017445.1|:c535367-534855 Erwinia sp. Ejp617 chromosome, complete genome
ATGCACAGACTCTCGATTTCTCGCCTGATAACTCAGGCGTTTTTACTGGCAGCGTTTACCCTGCTGGCCG
GTTGTGTTTCGTCTTCACGCAGTGTCCCCGCGCAATACAGCCTGGTTTTTCAGGCTCACCCTCAGATCAA
TGATTCGGCTCCGCTAAAGGTGCGGGTGCTGTTGCTGAAGTCGGATGCGGATTTTATGGCGGCTGACTTT
TACTCGCTGCAAACCAATCCGCAAGGAGTGCTGGGGCAAAACCTGTTGAACAGTGAGCAGTTTTTCCTGA
TGCCGGGGCAGACTGACAAAAAACGGGCCGGGCAGAGCAGCCCGGAGGCGCGTTATATCGGCATTATGGC
GGAATATCAAACGCTTGATGGCAAAAAGTGGCGAGTTTCTTTGCCGGTGCCCCTTCCTGCCGAACGCCAT
TTTTATCAAATTTGGCAAGGGGATGCGGATAATCTGCGCGCCGACGTTATCGCCGATATCAACGGTGTCC
GTGTTATTAACGCCCGCGATTAA