SecReT6
Protein ID: 385793279
SecReT6 ID774
T6SS typeii
Gene symbol-
Locus tagFNFX1_1347
StrainFrancisella cf. novicida Fx1
Repliconchromosome [GenBank: NC_017450] [Browse all T6SS(s) in this replicon]
Location [Strand]1377738..1380200 [+]
Producthypothetical protein
NotePdpA
UniProt IDF4BCN1
KEGG IDfcf:FNFX1_1347
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 820 a.a.     [Download]
>gi|385793279|ref|YP_005826255.1| hypothetical protein [Francisella cf. novicida Fx1]
MIAVKDITDLNIQNIISQLTSEVINGDTTPSSAKFACEINSYIINYNLSNINLINTQLKNTKILYRKGLI
SKLDYEKYKRYCIISRFKNNIDEFILYFSTNYKDSQSLKIAIKELQNSCSSSLILELPHDYIRKIDVLLT
SIDSAIQRSSDLNKTIIKQLNKLKSSLSRYIGYNNVLQKQEITINIKPINKNFELEDISFVSTRNKQYFK
HNSLTLKNPHIEKLEVCENIYGINGWLTFDLAYINNHKDFNFLLSPNQPILLDIQINDSFNFYKKESKKD
HHKRTTRFIAIGFNSNSMDIHENFEYSIYSYTKNVSSGVKKFKIQFHDPLKALWTKHKPSYIALNKSLDD
IFKENFFFDNLVSLDTNKSNNLKIRIPQAFISTVNRNFYDFFIQQLEQNKCYLKYFCDKKNGKVSYHIVD
HVDNDLQRNIINSDEDLKDKLSPYDISCFKKQILISNKSNFYVKEKNICPDVTLNTQKKEDRKISDTLIK
PFSSILKDNLQSVEYIQSNNNDKQEIITTGFEILLTSRNTLPFLDTEINLSKLDNDQNYLLGATDIKTLY
MSQRKLLFKRSKYCSEQLYENLHNFHYKSDAESDVYEKIAFTKYPSLTHDNLITYKIKDYSNLTPEYPKY
KSFSNFYINGRITIGENVNNDSKKAYKFFKNHKPEESSIAEFQENGEKGTSAILNSKADILYAIEIAKEM
LSDKSSDKPIIYLPLKVNINSANNQFIPLRNDDIILIEIQSFTKGEIIELISNSAISTKKAQQQLLQRQL
LGSKENCEMAYTQTSDSETFSLTQVNEDCENSFLINDKKGIFLRYKSKGN
 
Nucleotide Sequence: 2463 bp     [Download]
>gi|385791932|ref|NC_017450.1|:1377738-1380200 Francisella cf. novicida Fx1 chromosome, complete genome
ATGATAGCAGTAAAAGATATAACTGATTTAAATATACAAAACATAATTAGTCAGTTAACTTCTGAAGTTA
TAAATGGCGACACAACCCCTTCTTCCGCCAAGTTTGCTTGTGAAATTAATAGCTATATTATTAATTACAA
CCTATCAAACATTAATCTTATTAATACTCAACTAAAAAATACAAAGATACTTTATAGAAAAGGCTTGATA
TCTAAGCTTGATTACGAAAAATATAAAAGATATTGCATAATATCTAGATTTAAAAATAACATAGATGAAT
TTATCTTATATTTTTCGACAAACTATAAAGACTCTCAAAGCTTAAAAATCGCAATTAAAGAATTACAAAA
CTCATGCTCATCAAGTTTAATTCTTGAGCTTCCTCATGATTACATAAGAAAAATTGATGTCTTACTAACT
AGTATAGATAGTGCAATACAAAGATCAAGCGATCTCAACAAAACAATTATAAAACAGTTAAATAAGCTTA
AAAGCAGCCTTTCACGATATATTGGGTATAATAATGTACTACAAAAACAAGAAATTACTATAAATATAAA
GCCTATTAATAAAAATTTTGAACTTGAGGATATAAGTTTTGTATCAACTAGAAATAAGCAATATTTTAAG
CATAACTCTCTTACACTTAAAAACCCTCATATTGAAAAATTAGAAGTATGTGAAAATATCTACGGCATAA
ACGGCTGGTTAACTTTTGATTTAGCATATATCAATAATCACAAAGACTTTAACTTTCTATTAAGCCCAAA
TCAACCCATATTGCTTGATATTCAAATTAATGATAGCTTCAACTTTTACAAAAAAGAATCTAAAAAAGAT
CATCATAAGAGAACAACCCGTTTTATAGCCATTGGCTTTAATTCAAACAGTATGGATATTCATGAGAACT
TTGAATATAGCATATATTCTTATACCAAAAATGTTTCTTCAGGAGTAAAAAAATTTAAAATACAATTCCA
TGACCCACTAAAAGCACTTTGGACTAAGCACAAACCATCTTATATAGCTTTAAATAAAAGCTTAGATGAT
ATCTTTAAAGAGAATTTTTTCTTTGATAATTTAGTTTCTTTAGATACCAACAAAAGTAATAATCTAAAAA
TACGTATACCACAAGCATTTATTTCTACAGTTAATCGAAATTTTTATGATTTCTTTATTCAACAACTTGA
GCAAAATAAATGTTATTTAAAATATTTCTGTGATAAGAAGAATGGCAAAGTAAGCTATCATATTGTAGAT
CATGTAGATAATGACTTACAAAGGAATATCATAAATTCAGATGAAGATTTAAAAGACAAACTATCTCCTT
ATGATATAAGCTGCTTCAAAAAACAAATTCTAATCTCAAATAAATCAAACTTTTATGTTAAGGAAAAAAA
TATATGTCCTGATGTGACTTTAAACACTCAAAAAAAGGAAGATCGAAAGATTTCAGATACCTTAATAAAG
CCATTCTCATCCATACTCAAGGATAACTTACAATCTGTAGAGTATATACAAAGTAATAATAATGATAAAC
AAGAAATTATTACTACAGGATTTGAGATATTACTGACATCAAGAAATACTCTGCCCTTCTTAGATACTGA
AATTAATCTTTCTAAACTAGACAATGATCAAAACTATCTTTTAGGCGCAACAGATATAAAAACCTTATAT
ATGAGTCAAAGAAAGCTATTATTTAAAAGAAGTAAATACTGCTCTGAACAACTATATGAAAACTTACATA
ACTTTCACTATAAAAGTGACGCTGAATCAGACGTATATGAAAAAATTGCTTTTACTAAATACCCTAGTCT
GACACATGACAACTTAATAACTTATAAAATTAAAGATTATAGTAATCTAACTCCTGAATATCCTAAATAC
AAAAGTTTTAGTAACTTTTATATTAATGGTAGAATAACGATTGGAGAAAATGTTAATAATGACTCCAAAA
AAGCTTATAAATTCTTTAAAAATCATAAGCCAGAAGAAAGCTCAATCGCAGAATTTCAAGAAAATGGTGA
AAAAGGTACTTCAGCTATACTAAATAGTAAGGCTGATATCTTATACGCAATAGAAATTGCCAAGGAAATG
TTATCTGATAAATCATCAGATAAGCCAATCATATACTTACCTCTAAAAGTAAACATAAATTCTGCTAATA
ATCAATTTATACCATTGAGAAATGACGATATTATCTTAATTGAAATACAGTCTTTTACTAAAGGTGAAAT
TATTGAGTTAATTTCGAACTCTGCCATATCAACAAAGAAAGCTCAGCAGCAACTACTACAACGACAACTT
CTTGGATCTAAAGAAAACTGTGAAATGGCATATACCCAAACAAGTGATAGCGAGACATTCTCACTAACTC
AAGTAAATGAAGATTGTGAGAATTCTTTTTTGATAAATGATAAAAAAGGTATTTTTCTAAGATATAAATC
AAAAGGAAATTAA