SecReT6
Protein ID: 385793280
SecReT6 ID774
T6SS typeii
Gene symbol-
Locus tagFNFX1_1348
StrainFrancisella cf. novicida Fx1
Repliconchromosome [GenBank: NC_017450] [Browse all T6SS(s) in this replicon]
Location [Strand]1380205..1383486 [+]
Producthypothetical protein
NotePdpB
UniProt IDF4BCN2
KEGG IDfcf:FNFX1_1348
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 0.00052, Aligned region: 847..942
Protein Sequence: 1093 a.a.     [Download]
>gi|385793280|ref|YP_005826256.1| hypothetical protein [Francisella cf. novicida Fx1]
MNFIKNHQILIISLTIAIIVLSVLGIFMIKKWLKTSRNPNKKSASKTIKNAKSLIKKNKVKNNLSELYIF
YGDYLAAKDYITKIKPQAQIIDNNELPLIAIDKNNTSLVFANNEFSYLYKLKKKLNLQFYKLNFCFDISD
DYYHENIKISEIYKELLKLRLKNFIISFYTLSENTRSYNNAIDKKSIFKLTSDADTNHKAEEEILSKILS
SKDDVNNKYNNVKILNQIRKLLKNIYPQLKSINKEIFFNFGLNTPDNIIAKSDTIFFSSSPKGIIINLIS
LLFSFIFIINIFQEINIKEKLSIQELNQPHESDSNKIIKEARKKIDDAILLDILYPKSIKYHFIYEQYAD
TLLKNVILPKYNDTYDLSMITSFLIFFEYLDNKIINQHTNRILKIISSITNLSEKQLDIVIKYTTPSIRT
EMIKSAINRANKLYTNRLIVVGEDSESYLSTKGFNAEYLGISNTKRAKVINNIYIQYLYKCATDNAILDL
SDNYIIPTEVNNIFKMYQEQFDTSSKKLCNSSYINSITKSVSLILNQEENKRKFESFSDMLDHIYYLVKS
LEKNAKDVADDGKEQTSSITVSLINYVINSIVNPTYNKNELPLINPVSKNLYMEFAPNFYSKRILISPIY
SKEYIKDNIDPINKKFNRLVNNLKNNFNIEPDFMIAIYKSSINNYIEKYIGSYNKMIDSLNNDSEFNKNI
SNKSALKLYLLAMSSKDSSFNSLIEFYSTNTDLITNESETNSSKKINKLQHFYGEITKLNKQDNTNDQND
KSLWAPIDNYFKENDKYLESKSYADYKNIFKQLNNLIIEQGYSSTYKNIKQGYEPLQKVYSELSKINNHQ
GNNNLYKLLKKHLDIAINAIKTIAIQDAITKLDNTVNIEYEYINNQFPFNKDSNSAATNEAITKDFDNNG
YIYSGFIEQLSPLLSYNKTDDRWESKDFSKPEEIDYLNKFNKVYLLNKLLWDDKRNPKAIKFDITPIPNK
DNDYTFFSIILDKQNYVNSLNIKYSDSIEVLYNWNSLESTTITIKFEDGSNEQISYQGKWSILKAIKDAN
CDQNNICTWVIKHKGKKYPVSFKIESKFLQVLGWQKQGEVNVQ
 
Nucleotide Sequence: 3282 bp     [Download]
>gi|385791932|ref|NC_017450.1|:1380205-1383486 Francisella cf. novicida Fx1 chromosome, complete genome
ATGAATTTTATTAAAAATCATCAAATATTAATAATTTCACTAACTATAGCAATAATTGTTTTATCAGTAC
TTGGTATTTTTATGATTAAAAAATGGCTTAAAACATCAAGAAATCCTAACAAAAAATCTGCCTCAAAGAC
CATAAAAAATGCAAAATCATTGATCAAAAAGAATAAAGTAAAAAACAACTTAAGTGAATTGTATATTTTC
TATGGGGACTATCTAGCAGCTAAAGATTATATAACAAAGATAAAACCTCAAGCTCAAATCATTGATAATA
ATGAACTCCCTTTAATAGCTATTGATAAAAACAATACATCTCTCGTATTTGCAAATAATGAATTTTCGTA
CCTATATAAGTTAAAAAAGAAACTAAATCTACAGTTTTATAAGCTTAACTTTTGTTTCGATATATCCGAT
GATTACTACCATGAAAATATCAAAATTAGTGAAATCTATAAAGAACTATTAAAATTAAGATTAAAAAACT
TCATAATATCTTTTTACACCTTGTCTGAGAATACTAGAAGCTATAATAATGCAATTGATAAAAAATCAAT
ATTTAAATTAACTTCTGATGCAGATACAAATCATAAAGCTGAAGAGGAAATATTATCAAAAATTCTTAGC
TCTAAAGATGATGTTAATAATAAATACAATAATGTTAAGATATTAAATCAAATAAGAAAGTTACTAAAAA
ACATCTACCCTCAATTAAAATCTATAAATAAAGAAATATTCTTTAATTTTGGGCTAAACACACCAGATAA
TATTATAGCAAAGAGTGATACAATATTTTTTAGCAGCTCTCCAAAAGGTATTATTATAAACTTAATATCT
TTGTTATTTAGTTTTATATTTATCATTAATATTTTTCAAGAAATTAACATTAAAGAAAAACTCTCTATAC
AAGAGCTTAATCAACCACATGAAAGCGACTCTAATAAAATAATAAAAGAAGCTAGAAAAAAAATTGATGA
TGCTATACTTCTAGATATCCTATATCCAAAATCGATAAAATATCATTTCATATACGAACAATATGCTGAT
ACTCTCCTAAAGAATGTAATCTTACCAAAATATAATGATACATATGACTTATCAATGATTACATCATTTT
TAATATTTTTTGAGTATTTGGATAACAAAATTATTAACCAACATACGAATAGAATACTTAAAATAATAAG
CAGTATCACCAACCTATCTGAAAAGCAGCTAGATATCGTGATCAAGTATACGACCCCAAGTATAAGAACT
GAAATGATTAAGTCAGCCATCAACAGAGCAAATAAACTTTATACAAATCGTTTAATAGTTGTAGGTGAAG
ACTCCGAAAGTTACTTAAGTACTAAAGGATTTAATGCTGAATACTTAGGGATTTCAAATACTAAAAGAGC
GAAGGTCATAAATAATATTTATATACAATACCTATATAAATGTGCTACAGATAATGCAATTTTAGATTTA
AGCGATAACTACATAATACCAACAGAAGTAAATAATATCTTCAAGATGTATCAAGAGCAATTTGACACAT
CATCTAAAAAGCTATGTAATTCATCATATATTAACTCTATTACAAAGAGTGTTTCTTTGATACTTAATCA
AGAGGAAAATAAAAGAAAATTTGAAAGCTTCAGTGATATGCTAGACCATATCTATTATTTAGTAAAATCA
TTAGAAAAAAATGCTAAAGATGTCGCAGATGATGGTAAAGAACAAACTAGCTCGATAACAGTATCGCTTA
TAAATTACGTTATAAATAGTATTGTCAACCCTACTTATAATAAAAATGAGCTCCCACTAATAAATCCAGT
AAGTAAAAACCTATATATGGAGTTTGCTCCTAATTTCTATAGTAAAAGAATACTTATCTCTCCAATATAC
TCAAAAGAATATATTAAAGATAATATAGATCCTATAAATAAAAAGTTTAATAGACTCGTCAATAATCTAA
AGAATAACTTCAATATAGAACCCGACTTTATGATTGCTATCTATAAAAGTTCTATAAATAACTACATTGA
AAAATATATAGGATCCTATAATAAGATGATTGATAGCCTTAATAATGACTCTGAATTTAACAAAAATATA
TCTAACAAGAGTGCTCTTAAATTATATTTGCTAGCAATGTCATCAAAGGATTCTTCCTTTAATAGCCTAA
TAGAGTTTTATAGCACTAATACAGACCTAATAACTAATGAATCCGAAACCAATTCATCTAAAAAGATAAA
TAAGCTTCAACATTTTTATGGAGAAATAACTAAATTAAACAAACAAGACAATACTAATGATCAAAATGAT
AAGTCATTGTGGGCGCCTATAGATAACTACTTTAAAGAAAACGATAAATATCTTGAGTCTAAGAGTTATG
CCGACTATAAAAATATATTTAAACAGTTAAATAATCTAATAATAGAACAAGGCTATTCAAGTACATATAA
AAATATCAAACAAGGATATGAACCACTACAAAAAGTTTACTCTGAGCTTTCTAAGATAAATAATCATCAA
GGTAATAATAACTTATATAAACTGTTGAAGAAACATCTAGATATTGCCATTAATGCTATAAAAACTATCG
CCATACAAGATGCTATAACTAAACTTGATAATACTGTCAATATTGAGTACGAATACATAAATAATCAATT
CCCTTTTAATAAGGATAGTAACTCGGCTGCAACAAATGAAGCTATAACCAAAGACTTTGATAACAATGGT
TATATATACTCTGGATTTATAGAGCAACTATCTCCACTACTTTCTTATAATAAAACTGATGATAGATGGG
AAAGTAAAGATTTTTCAAAACCTGAGGAAATAGACTATCTAAATAAATTCAATAAGGTATATCTTTTAAA
TAAGCTACTATGGGATGATAAAAGAAATCCAAAAGCTATAAAATTTGATATAACTCCTATACCAAACAAA
GATAATGATTATACATTTTTTAGCATAATCCTCGATAAGCAAAACTATGTAAACTCATTAAACATAAAAT
ATTCAGATAGTATTGAAGTTTTGTACAACTGGAATTCACTTGAGTCAACAACTATTACCATAAAATTTGA
GGATGGTAGTAATGAGCAAATAAGCTATCAAGGAAAATGGTCTATATTAAAAGCAATTAAAGACGCAAAT
TGTGATCAAAACAATATTTGTACCTGGGTAATCAAGCACAAAGGTAAAAAATATCCTGTAAGCTTCAAAA
TAGAATCAAAATTCTTACAAGTATTAGGCTGGCAAAAACAAGGAGAAGTTAATGTACAATAA