SecReT6
Protein ID: 385793283
SecReT6 ID774
T6SS typeii
Gene symbol-
Locus tagFNFX1_1351
StrainFrancisella cf. novicida Fx1
Repliconchromosome [GenBank: NC_017450] [Browse all T6SS(s) in this replicon]
Location [Strand]1384365..1386095 [+]
Producthypothetical protein
NoteIglF
UniProt IDF4BCN5
KEGG IDfcf:FNFX1_1351
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 576 a.a.     [Download]
>gi|385793283|ref|YP_005826259.1| hypothetical protein [Francisella cf. novicida Fx1]
MNNDIDKWFENLFNNIHLYYKQEQSYKISKLNECITNVIKFINIKDYRKFDIYDLTYLIEDIKYSTNLIL
SDSALDFHNLILKNLDNLLDSIDIKYFASLMKNLKTLLENYKLIIERDISHRIELIKTKQIDKLESTFLD
YIKNDNTRAYDDRLVKLYVKTIQNPNSIEAIDEYKSYFDAIKIFIKDHKNIDNFTPFRKNPILSLLRLAY
LIKNNLYKIDRLLASDIILLRALYSINKDTYKLSLINEKTDTNLSIVSLTSLQAKPSENLKKTIDFIDLQ
IFAISQYFDDFPLQDIFFQKKSQIDIFKSESLEQLIFSLKNISNIMFDEETLYKKTHIKNQLYKNLFLNN
HNNLIEDIIEKSPAKLLTKLANKYFQILLDIATIINIQLVNNNLKLIYPFLEFEKYFNQVTLEISKKSQF
NQEKLEKNILNIIRIYPSLNQNYQLLKDMEQKIIDDKNSIESNDIYKLSVFVNSKSFSTYKEIRTLTSND
HKDINIHKSLVKVNKNICNAKHKNAAETAKELTMVLLSKSYYMNPILIGIYNLPPISNSFFLVLKEITNN
PIIDSIKSKQEAYWKI
 
Nucleotide Sequence: 1731 bp     [Download]
>gi|385791932|ref|NC_017450.1|:1384365-1386095 Francisella cf. novicida Fx1 chromosome, complete genome
ATGAATAATGATATTGATAAATGGTTTGAGAATTTATTTAACAATATCCACTTATATTATAAACAAGAGC
AATCTTATAAAATAAGTAAGCTTAATGAGTGCATCACTAATGTAATCAAATTTATAAATATAAAAGATTA
TAGAAAATTTGATATCTACGATCTGACATACCTCATCGAAGACATAAAATACTCAACAAATCTAATTTTA
TCTGACTCTGCCTTAGATTTTCATAATCTAATATTAAAAAATTTGGATAACCTACTAGATTCTATTGATA
TTAAGTATTTCGCTAGTCTTATGAAAAATTTAAAAACCCTTTTGGAAAATTACAAACTGATAATAGAGAG
AGATATATCACATCGAATAGAACTTATAAAAACTAAGCAAATCGATAAGTTAGAGTCTACATTTTTAGAC
TATATAAAGAACGATAATACCCGTGCTTATGATGATAGGCTTGTAAAATTATATGTAAAAACTATACAAA
ATCCCAATTCCATTGAGGCTATAGATGAGTATAAATCATATTTTGATGCGATCAAAATATTTATAAAAGA
CCATAAAAATATAGATAACTTCACTCCCTTTAGAAAAAATCCTATTTTAAGCTTATTAAGATTAGCTTAT
TTAATAAAAAACAATTTATATAAAATAGATCGTCTTTTAGCTAGCGATATTATTCTTTTAAGAGCTTTAT
ATTCTATAAATAAAGATACATATAAATTAAGTCTTATAAATGAAAAAACAGATACTAACCTATCAATAGT
TTCGCTGACGTCACTACAAGCTAAGCCCTCAGAAAACTTAAAAAAAACTATTGATTTTATAGATTTACAG
ATATTTGCTATATCTCAGTATTTTGATGATTTCCCTTTACAGGATATTTTTTTTCAAAAAAAATCACAAA
TAGACATTTTCAAGTCAGAATCACTAGAACAACTTATTTTCAGTTTAAAAAATATTTCAAATATAATGTT
TGATGAAGAAACACTATATAAAAAAACCCATATAAAAAATCAACTCTACAAAAACCTTTTTTTAAATAAT
CACAATAATTTGATAGAAGATATTATAGAAAAATCTCCGGCAAAATTATTAACAAAGTTAGCTAATAAAT
ACTTCCAAATACTGCTAGACATAGCAACAATAATAAATATTCAATTAGTAAATAATAATTTAAAGCTTAT
TTATCCTTTCTTAGAGTTTGAAAAATATTTTAATCAAGTAACTTTAGAAATATCAAAAAAATCACAGTTT
AATCAAGAAAAGCTAGAAAAAAATATTCTAAATATTATCAGGATATATCCTTCACTAAATCAAAACTACC
AATTATTAAAGGATATGGAACAAAAAATTATTGATGATAAAAATAGTATAGAATCAAACGATATATATAA
GCTTAGTGTTTTTGTAAATAGCAAAAGTTTTTCTACCTATAAAGAAATCAGAACCTTAACCTCAAATGAC
CATAAAGATATTAACATCCACAAATCTTTAGTAAAAGTGAACAAAAATATTTGTAATGCCAAACATAAGA
ATGCCGCTGAAACAGCTAAAGAGCTAACGATGGTTCTTTTAAGTAAATCTTACTATATGAATCCAATTTT
GATAGGAATATATAATCTACCGCCAATTTCAAATAGTTTTTTTTTGGTGCTTAAAGAGATTACAAATAAT
CCGATCATTGATAGTATAAAAAGCAAGCAAGAAGCTTATTGGAAAATTTAA