SecReT6
Protein ID: 385793284
SecReT6 ID774
T6SS typeii
Gene symbol-
Locus tagFNFX1_1352
StrainFrancisella cf. novicida Fx1
Repliconchromosome [GenBank: NC_017450] [Browse all T6SS(s) in this replicon]
Location [Strand]1386096..1386617 [+]
Producthypothetical protein
NoteIglG
UniProt IDF4BCN6
KEGG IDfcf:FNFX1_1352
PDB IDNA
Domain hit(s) vs Pfam DUF4280 [PF14107], Evalue: 1.30E-16, Aligned region: 58..167
Protein Sequence: 173 a.a.     [Download]
>gi|385793284|ref|YP_005826260.1| hypothetical protein [Francisella cf. novicida Fx1]
MLNIINDSLKRLEEITTDDESISSSVSDLVADLNNIKILLAQSKPHLSSNASILTTSMGAQIKCSYSLGS
GIYLSTRIKTLTNNLPASNITDSKLGANILPFAGCTNPANPTMNPFSFPWVCIPNLSAFIPTNPTTLLEN
APITTINSKAMCMFAPGGIVDFISSGQINVKTS
 
Nucleotide Sequence: 522 bp     [Download]
>gi|385791932|ref|NC_017450.1|:1386096-1386617 Francisella cf. novicida Fx1 chromosome, complete genome
ATGTTAAATATTATAAATGACTCCTTAAAACGCTTGGAAGAAATAACGACCGATGATGAAAGTATTAGTA
GCTCAGTATCTGATCTAGTGGCGGATTTAAACAATATAAAAATTTTATTAGCTCAATCAAAACCACACTT
ATCAAGCAATGCGTCAATATTAACCACATCAATGGGAGCACAAATTAAATGCTCATATAGTCTTGGATCA
GGAATTTATCTTAGTACAAGAATAAAAACACTAACGAACAACTTACCAGCTTCAAATATTACCGATTCTA
AACTAGGAGCTAACATTTTACCTTTTGCTGGATGTACAAATCCAGCAAACCCTACAATGAACCCATTTAG
CTTTCCTTGGGTATGTATACCAAACTTATCTGCTTTTATTCCCACGAACCCTACTACACTACTAGAAAAT
GCTCCTATAACTACAATAAATAGTAAAGCAATGTGTATGTTTGCTCCGGGTGGTATAGTTGATTTTATTA
GTAGTGGACAAATAAATGTAAAAACATCTTAG