SecReT6
Protein ID: 385793285
SecReT6 ID774
T6SS typeii
Gene symbol-
Locus tagFNFX1_1353
StrainFrancisella cf. novicida Fx1
Repliconchromosome [GenBank: NC_017450] [Browse all T6SS(s) in this replicon]
Location [Strand]1386630..1388060 [+]
Producthypothetical protein
NoteIglH
UniProt IDF4BCN7
KEGG IDfcf:FNFX1_1353
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 476 a.a.     [Download]
>gi|385793285|ref|YP_005826261.1| hypothetical protein [Francisella cf. novicida Fx1]
MDEKRKDLSMNDASILKKTFDKLSNDIRDDFDKRIFDYSNALLFKYYSNLYYFVPKSCLLEINDKGHNGY
YIPPQEYFFIEDKRTGKTLTYTTKSENIILPIKDIKTIKQSDTSINISLEFANNFDYDYVTIWIDPTLCK
EDPSFATYIFNQVLEDNGSAKIKFSNHSYTTKNLQIEPIKFQLKPTEKLVLNIHSPSLLYGFNIKIKDLF
KYKNNDLNKIDFFLEVKTENYNDEKLSSLFRVNLIPVFNSFDDYSSASFASMNLSESKLKHHQKDDAQAI
EVLSVYENNKQCDFNSFLFVGQNEYYFNRSTQSLNYSSVLPQFSNKIIGTKIHTYTTWTQITEISDIIEI
NSNAIASISCNISPIVINKALNNYNSNAKEMFNIIDMIISKNMYSKTTFLAIAKLLKINTNDLTLLSMLL
QDVEMDSTINELILTLSDKYNPKYKHFLNFYIGIICKFINQNTFSFIKKIVLNNSI
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|385791932|ref|NC_017450.1|:1386630-1388060 Francisella cf. novicida Fx1 chromosome, complete genome
ATGGATGAAAAAAGAAAAGATTTAAGTATGAATGATGCCAGCATCCTAAAAAAAACTTTTGACAAATTAA
GTAATGATATAAGAGATGATTTTGATAAGAGAATTTTTGATTATAGTAATGCTCTTTTATTCAAGTATTA
TAGTAACCTTTATTATTTCGTTCCTAAATCATGCTTATTAGAAATAAATGATAAAGGACACAATGGTTAC
TATATTCCGCCTCAGGAATATTTTTTCATAGAAGACAAGAGAACAGGTAAAACTCTAACATATACGACAA
AGTCAGAAAATATAATACTCCCTATTAAAGATATCAAAACCATAAAACAAAGTGATACATCAATAAATAT
ATCATTGGAATTTGCAAATAACTTTGACTATGATTATGTTACTATCTGGATAGATCCAACTTTATGTAAA
GAAGATCCTAGCTTTGCCACATACATATTTAACCAAGTATTAGAAGATAATGGCTCAGCAAAGATTAAAT
TTTCAAATCATAGTTATACAACAAAAAATCTACAAATAGAACCAATTAAGTTCCAATTAAAACCAACAGA
AAAGTTAGTTCTCAATATCCATTCTCCTAGCCTTTTATATGGTTTTAACATAAAGATCAAAGACTTATTT
AAATACAAAAATAATGACCTCAACAAAATTGACTTTTTTTTAGAAGTTAAAACTGAAAACTATAATGACG
AAAAATTATCATCTCTATTTAGAGTTAATTTAATACCTGTGTTTAATAGTTTTGATGATTACTCAAGCGC
CTCATTTGCTTCGATGAATCTCTCAGAGAGTAAACTAAAACATCATCAAAAAGATGATGCTCAAGCAATA
GAAGTATTATCTGTTTATGAGAATAATAAACAATGTGATTTTAATAGTTTTCTTTTTGTAGGACAGAATG
AGTATTATTTTAATCGCAGCACACAATCTTTAAATTATAGTAGCGTACTCCCTCAATTTAGTAATAAAAT
AATAGGAACAAAAATACATACATATACAACCTGGACACAGATAACTGAGATTTCTGATATAATTGAAATT
AACTCAAATGCAATAGCATCTATAAGCTGTAATATTTCTCCAATAGTTATTAACAAAGCACTAAACAACT
ACAATAGCAATGCTAAAGAAATGTTTAATATAATAGATATGATCATCTCTAAGAATATGTATTCAAAAAC
AACATTCCTAGCTATAGCAAAGCTTTTAAAGATTAATACTAATGACTTAACTTTACTATCAATGCTCCTA
CAAGATGTTGAGATGGACTCTACTATAAATGAGCTAATTTTAACCTTAAGTGATAAATATAACCCAAAAT
ATAAACATTTCTTAAATTTTTATATTGGTATTATATGCAAATTTATAAATCAAAACACCTTTAGCTTTAT
TAAAAAGATTGTTTTAAATAACTCTATATAA