SecReT6
Protein ID: 385793286
SecReT6 ID774
T6SS typeii
Gene symbol-
Locus tagFNFX1_1354
StrainFrancisella cf. novicida Fx1
Repliconchromosome [GenBank: NC_017450] [Browse all T6SS(s) in this replicon]
Location [Strand]1388073..1388696 [+]
Producthypothetical protein
NoteDotU
UniProt IDF4BCN8
KEGG IDfcf:FNFX1_1354
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.80E-11, Aligned region: 28..205
Protein Sequence: 207 a.a.     [Download]
>gi|385793286|ref|YP_005826262.1| hypothetical protein [Francisella cf. novicida Fx1]
MKDFKEIEIILDIIKTTREIIEDNDNDNEKISYHRNNIRKSIFFLQEELLEKYSETVCKYIVFPLLAYVD
EKLMLLREKSASNISWSLLQLEYYDRKDGGEYVFEITDNILSENIYPQICYQTISLILHNDFYGKYYDNI
YNHSFLAYKKEIDKHIENSTIDSVNFIDIPVNSPPLSRKYSKTLKFLLRIGVPLGLFLLSLLILLSW
 
Nucleotide Sequence: 624 bp     [Download]
>gi|385791932|ref|NC_017450.1|:1388073-1388696 Francisella cf. novicida Fx1 chromosome, complete genome
ATGAAAGACTTTAAAGAGATAGAAATTATTCTAGATATCATAAAAACTACAAGAGAAATTATAGAAGATA
ATGATAATGATAATGAGAAAATATCATACCATCGTAATAATATAAGAAAAAGTATTTTCTTCCTACAAGA
AGAGCTCTTAGAAAAATATAGTGAAACTGTCTGTAAATATATAGTTTTTCCGTTACTTGCATATGTTGAT
GAAAAATTGATGCTACTTAGGGAAAAGTCAGCAAGCAATATTTCTTGGAGTCTACTACAATTAGAATATT
ATGATAGAAAAGATGGTGGTGAATATGTTTTTGAGATAACTGATAATATTTTATCAGAGAATATCTATCC
ACAAATTTGCTACCAGACAATATCACTTATCCTACACAATGACTTCTATGGCAAATACTATGACAATATA
TATAACCATAGCTTTCTTGCTTATAAGAAAGAAATTGATAAGCATATAGAAAATTCGACAATTGATTCGG
TTAATTTTATTGATATACCCGTTAATAGTCCCCCACTGTCAAGAAAATATAGTAAGACGCTTAAATTCTT
ATTAAGAATAGGCGTTCCTTTAGGACTGTTTCTTTTAAGCTTACTAATTTTATTAAGCTGGTAA