SecReT6
Protein ID: 385793288
SecReT6 ID774
T6SS typeii
Gene symbol-
Locus tagFNFX1_1356
StrainFrancisella cf. novicida Fx1
Repliconchromosome [GenBank: NC_017450] [Browse all T6SS(s) in this replicon]
Location [Strand]1389892..1390608 [+]
Producthypothetical protein
NoteIglJ
UniProt IDF4BCP0
KEGG IDfcf:FNFX1_1356
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 238 a.a.     [Download]
>gi|385793288|ref|YP_005826264.1| hypothetical protein [Francisella cf. novicida Fx1]
MQHINNINKNISLNNFVSLLKSQKYSLKRINFIPVMINKTSSPTILDIYDNKETLNVKINIFKIKPFTKL
QSIYQEYIQNNNDLAIEILGYGLKVLLKLYILDTKALHKFTTKNSYYIQCAPKYTIDNIINNIYKLLSED
YCTVIDYKEKLINIKRKQTLIGSSYVGETSLGGYIPSNIYSISINIYLIRKNEYILDKIKTQIKKIEEKI
TNLPFKIELEISVENNKKNQIYLGYFNL
 
Nucleotide Sequence: 717 bp     [Download]
>gi|385791932|ref|NC_017450.1|:1389892-1390608 Francisella cf. novicida Fx1 chromosome, complete genome
ATGCAACACATCAATAATATCAATAAAAATATCTCTCTAAATAACTTTGTGAGCCTTCTAAAAAGTCAGA
AATATTCTTTGAAAAGAATAAATTTCATACCGGTAATGATTAATAAAACCTCATCTCCTACCATATTAGA
TATTTATGATAATAAAGAAACTCTAAATGTAAAAATAAATATCTTTAAAATCAAACCATTCACTAAATTA
CAGAGTATTTATCAAGAATATATCCAAAACAATAATGACTTGGCTATTGAAATACTTGGATACGGATTAA
AAGTGCTACTAAAGTTATACATTTTAGATACTAAAGCACTGCACAAATTCACAACAAAAAATAGTTATTA
TATTCAATGTGCTCCCAAATACACTATAGATAACATAATAAACAATATCTATAAATTACTCTCGGAAGAC
TATTGCACAGTAATAGATTATAAAGAAAAACTAATCAATATAAAAAGAAAACAAACGTTAATTGGAAGTT
CTTACGTTGGAGAAACTTCCTTGGGAGGATATATACCCTCAAATATATATAGTATAAGTATTAACATATA
CCTGATTAGAAAAAATGAATATATTTTAGATAAAATCAAAACTCAAATTAAAAAAATTGAGGAAAAAATT
ACAAATCTCCCATTTAAGATAGAACTTGAAATATCAGTTGAAAATAATAAAAAAAATCAGATATATCTAG
GTTATTTTAATTTATGA