SecReT6
Protein ID: 385793289
SecReT6 ID774
T6SS typeii
Gene symbol-
Locus tagFNFX1_1357
StrainFrancisella cf. novicida Fx1
Repliconchromosome [GenBank: NC_017450] [Browse all T6SS(s) in this replicon]
Location [Strand]1390648..1394625 [+]
Producthypothetical protein
NotePdpC
UniProt IDF4BCP1
KEGG IDfcf:FNFX1_1357
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1325 a.a.     [Download]
>gi|385793289|ref|YP_005826265.1| hypothetical protein [Francisella cf. novicida Fx1]
MNDKYELNIYFEKIELPKTADFNMISKHDIKELRVDANLKKKIHLLQFDEDYLAYMRSLRAIHPSKIAMQ
KIKSLRNKKNSFIIAILSLDKIIHKTKFISFGHKTVIFDFKKLWGLVDFVIVHTSNKTWVNHKLTSFMPS
ITYCNQNIIHLAYHSDFLYIYHTPEFMDDINVDRENRRELVAKIPDPYWVRADTKENKININSEEENIEK
DLKKITKLKNFEISANDIFFSKAIKAAPRLQHKNKSKLFNSLAIENNEKIKRDIIDYAISNAWYKNEGLL
ENLMTFLDALVVRHLYLIAVYSVYEIEIGIKSVKPEYSKLLKAGLLNKDIQNQLIYDQKKISNIIWLGET
FHGLDIEEAEDLCELIDQGDINPKINPINPEKLYRAYKENYGNEALSFREYKEKYNFLDNDKLREEHANK
LSSILEDPKFRVLSYINAFLCSTKNYLVPYGYLGSNPLTYYNCMLETGKRRTSKEAYFADIRNKLFMVCY
LPGFLSSVIADDDFIDWYSNKKENQELLKNSYLNNLYKSKQKYIKDFIDLDIIKLLKQTSSQIKPSYIPV
AFRYGAFASTTALIRSNANVSNRMEFELYDSPERLHNQYSEKEEMIMPKSVNNPKDHSIDNGISLFSLNL
TNEKEDGLRKVMLKVAQLYNLDFKVGISGNLDQAMTQALILGMATTKKNGDILLDEDQMLYMTYLYCIFM
AHSVDHTVDEILMSANTYLLNSEEVKYPIFNIADFFARPVFGLSKDKEFKSLVEKYENSLKPNSKILKEN
YISRVVTLSEVYEDIYNLNCLYSSLSEGSLYNLLSTHSERHCTLLEQYSRKKKAEIGLVQDGEKIKVVNN
YSGYAAINQYQRFVSLGRMYDSGAKYSSSHKKQIEKDFNLYSPDKEQINYLKYNFKDNKFDAVYKNKKSK
EKNQSHIVYAKKQNTRYCYGYFNDFFVKNRITTFYKIKDKSGNYLVNLHNEKYSFATPNSDSKIYRVSPE
LLNNRDDFKRVSKDIIKSYKYISFDKQKEDIVKNFGKNLYHTNYEIWVGLSHQAISCFSVLDNIDTQEAA
NTFIDALYYVRLMQLYYGKTIPFLWISSEIVRYSSSETHYYIPTEENFENILKIALNNASKPVIERFLII
LNIYNSTIDDNALILIRCRLPIMLFEYEEQKLKLKALQKCTDDYKKNNYKNEINFSTWFESIFHVQNLSL
CPNYISDNTLIMNLVEQLETKCSEYKKNMINQQIKARANELNFYQLLIRLIEISTYHRILTKSIITNTTS
LLYDILNKPEFQTVNKLINKLFIYKNKDLNTDKYKDFHTKLITIEKTYKKINNLYKSDFFKKISS
 
Nucleotide Sequence: 3978 bp     [Download]
>gi|385791932|ref|NC_017450.1|:1390648-1394625 Francisella cf. novicida Fx1 chromosome, complete genome
ATGAACGACAAATATGAACTAAATATCTATTTTGAGAAAATAGAGTTACCTAAAACAGCAGATTTCAATA
TGATAAGCAAGCATGATATTAAAGAACTCAGAGTAGATGCTAATTTAAAAAAGAAAATACACTTATTACA
ATTTGATGAAGATTATTTAGCATATATGAGGAGCTTAAGAGCTATTCATCCCTCAAAAATAGCAATGCAA
AAAATTAAATCACTTCGCAATAAAAAAAATTCTTTTATAATTGCCATTTTATCTTTAGATAAAATAATTC
ACAAAACTAAATTTATCTCTTTTGGACATAAAACCGTTATTTTTGATTTTAAGAAACTATGGGGATTAGT
TGATTTCGTAATAGTTCATACAAGTAATAAAACCTGGGTTAATCATAAGTTAACATCATTTATGCCATCA
ATTACATACTGTAATCAAAACATCATCCATTTAGCATACCATTCTGATTTTTTATATATTTATCATACTC
CAGAATTTATGGATGATATAAATGTAGATCGAGAAAATAGAAGAGAGTTAGTGGCAAAAATTCCCGATCC
ATATTGGGTAAGAGCTGATACTAAAGAAAATAAAATCAATATTAATTCTGAAGAGGAAAATATAGAAAAA
GATTTAAAAAAAATAACTAAATTAAAAAATTTTGAAATAAGCGCAAATGATATTTTTTTCTCAAAAGCTA
TAAAAGCAGCTCCAAGATTACAACATAAAAATAAGAGTAAATTATTTAATTCATTAGCGATTGAAAATAA
TGAAAAAATCAAACGTGACATAATTGATTATGCAATATCTAATGCTTGGTATAAAAACGAGGGGTTACTT
GAAAATCTAATGACATTTTTAGACGCGCTAGTCGTAAGACATCTCTACTTAATAGCAGTTTACTCAGTTT
ATGAAATAGAAATAGGTATTAAATCAGTAAAACCTGAGTATAGCAAATTATTAAAAGCTGGCCTATTGAA
CAAAGATATTCAAAATCAATTGATATATGATCAAAAGAAAATTAGCAATATTATTTGGCTTGGTGAAACA
TTTCATGGTTTAGATATTGAAGAAGCAGAAGATTTATGTGAACTTATTGACCAAGGCGATATTAATCCAA
AAATTAATCCTATAAATCCTGAAAAGCTATATAGAGCCTATAAAGAAAATTATGGAAATGAAGCGTTAAG
CTTTAGAGAATACAAAGAAAAATATAATTTTTTAGATAATGATAAGCTTAGAGAAGAACATGCAAATAAA
CTTTCAAGCATATTAGAAGATCCAAAATTTAGAGTTCTTAGCTATATAAATGCATTTTTATGTTCAACTA
AAAATTATCTAGTACCTTATGGGTATTTAGGAAGTAATCCTCTTACATACTATAATTGTATGCTAGAAAC
CGGAAAACGTAGAACATCAAAAGAAGCATATTTTGCTGATATAAGAAACAAATTGTTTATGGTATGCTAT
CTTCCTGGCTTCTTGAGCTCTGTAATTGCTGATGATGACTTTATAGACTGGTATTCTAATAAGAAAGAAA
ATCAAGAATTACTCAAAAACTCTTATTTGAACAATTTATATAAGTCAAAGCAGAAATATATAAAAGATTT
TATAGATCTTGATATTATTAAACTTCTAAAACAGACATCATCTCAAATCAAGCCAAGCTATATACCAGTA
GCTTTTAGATATGGTGCATTTGCCTCAACAACTGCTTTGATAAGATCAAATGCAAATGTTTCTAATCGAA
TGGAGTTTGAATTATATGACTCACCTGAAAGACTACATAATCAATACTCAGAAAAAGAGGAAATGATTAT
GCCAAAATCGGTTAATAACCCCAAGGATCACTCAATTGACAATGGAATATCTTTATTTAGCCTTAATCTA
ACAAATGAAAAAGAAGATGGACTTCGAAAAGTTATGTTGAAAGTTGCACAACTATATAATCTTGATTTCA
AGGTAGGTATCTCAGGAAATTTAGATCAAGCAATGACTCAGGCATTAATACTTGGGATGGCAACTACAAA
AAAAAATGGCGATATCTTACTTGATGAAGATCAAATGCTATATATGACATACTTATACTGCATTTTCATG
GCACATAGTGTCGATCATACTGTAGATGAAATACTAATGTCTGCAAATACTTATCTGTTAAATTCTGAAG
AGGTAAAGTATCCTATATTTAATATAGCTGATTTTTTTGCTAGGCCTGTATTTGGACTCTCTAAGGATAA
AGAGTTTAAATCATTAGTTGAAAAGTATGAAAATAGCCTAAAACCTAATTCAAAAATTCTCAAAGAGAAT
TATATAAGTAGAGTAGTCACACTATCTGAAGTATATGAAGATATATATAACTTAAATTGTTTATATAGTT
CTCTCTCAGAAGGATCCTTGTATAATCTACTATCAACTCACAGTGAAAGACACTGTACTTTATTAGAGCA
GTATTCTCGCAAGAAGAAAGCTGAGATAGGATTAGTCCAAGATGGAGAGAAAATAAAAGTCGTAAACAAC
TACAGTGGCTATGCTGCGATTAATCAATATCAACGTTTTGTATCACTAGGCAGAATGTATGATAGTGGTG
CAAAATACTCCTCTTCTCATAAAAAACAGATAGAAAAAGATTTCAACTTATACTCACCAGATAAAGAACA
GATAAATTATCTAAAATATAACTTTAAAGATAATAAATTTGATGCTGTTTATAAAAACAAAAAGAGCAAA
GAAAAAAATCAAAGCCATATTGTGTATGCAAAAAAACAAAATACGCGATATTGCTACGGATATTTTAACG
ATTTTTTCGTTAAAAATAGAATTACGACTTTTTATAAAATAAAAGATAAATCAGGAAACTATTTAGTAAA
CTTACATAATGAAAAATATAGTTTCGCAACACCTAATTCAGATTCTAAAATATATAGAGTTTCACCAGAA
TTACTTAACAATAGAGATGATTTTAAAAGAGTATCTAAAGATATTATAAAATCATATAAATATATTAGTT
TTGATAAACAAAAGGAAGATATAGTTAAAAATTTTGGTAAAAACTTATATCATACTAATTATGAGATATG
GGTTGGGCTATCACATCAAGCTATATCATGTTTTTCAGTTTTAGATAACATAGATACACAAGAAGCTGCT
AATACTTTTATCGATGCTTTATATTATGTTAGATTAATGCAATTATATTATGGCAAAACTATACCTTTTT
TGTGGATTAGTAGCGAAATTGTAAGATATTCTTCATCAGAAACTCACTACTATATACCAACAGAAGAAAA
CTTTGAAAATATACTTAAAATTGCTCTTAATAATGCCTCAAAACCAGTAATAGAAAGATTCTTAATTATT
CTTAACATATATAATAGTACTATTGATGATAATGCTTTAATTTTGATACGATGCCGTTTACCAATAATGT
TATTTGAATATGAAGAGCAGAAACTCAAATTAAAAGCTTTACAAAAGTGTACTGACGATTATAAAAAAAA
TAATTATAAAAACGAAATTAATTTTAGTACTTGGTTTGAATCTATATTTCATGTTCAAAACTTATCCTTA
TGTCCTAATTATATTAGCGATAATACTTTAATCATGAATTTAGTTGAACAATTAGAAACTAAATGTAGTG
AATATAAAAAAAACATGATTAACCAACAAATTAAAGCTAGAGCAAATGAGTTAAACTTTTATCAACTTCT
AATAAGACTTATTGAAATATCAACTTATCATAGGATACTTACGAAATCAATCATAACTAATACAACCTCG
TTACTTTATGACATATTAAATAAACCAGAATTTCAAACAGTAAATAAATTAATAAATAAGCTATTTATTT
ATAAAAACAAGGATCTAAATACTGATAAATATAAAGACTTTCATACTAAGCTCATAACTATTGAAAAAAC
CTATAAGAAAATAAATAACTTATATAAATCAGACTTTTTTAAAAAAATATCGTCATAA