SecReT6
Protein ID: 385793290
SecReT6 ID774
T6SS typeii
Gene symbol-
Locus tagFNFX1_1358
StrainFrancisella cf. novicida Fx1
Repliconchromosome [GenBank: NC_017450] [Browse all T6SS(s) in this replicon]
Location [Strand]1394643..1395218 [+]
Producthypothetical protein
NotePdpE
UniProt IDF4BCP2
KEGG IDfcf:FNFX1_1358
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 191 a.a.     [Download]
>gi|385793290|ref|YP_005826266.1| hypothetical protein [Francisella cf. novicida Fx1]
MSKKIFKLLSISVIFSIYQQTFSNTITASIFKLENISKENAAISLNLSELCPTNITACKDENDNNCIYIT
ELTREPISLINYYLSVPITAKSAKDLTILYKHNKEVSPPEAINICLSLFKNNKYETYYSQVIYNWFVSSG
LYLSLSEGSIFIDTDSNNCSNYDKGKFLGVNLERIADGWAPPHYEKKITIK
 
Nucleotide Sequence: 576 bp     [Download]
>gi|385791932|ref|NC_017450.1|:1394643-1395218 Francisella cf. novicida Fx1 chromosome, complete genome
ATGAGTAAAAAAATATTTAAATTATTATCAATTTCAGTAATATTTAGTATATATCAACAAACATTTAGTA
ATACAATAACAGCTAGTATATTCAAATTAGAAAATATTTCTAAAGAAAATGCTGCTATCTCTCTAAATTT
AAGCGAGCTATGTCCAACTAATATAACAGCATGTAAAGATGAGAATGACAATAATTGTATTTATATAACT
GAATTAACTAGAGAACCAATTAGCCTTATAAACTATTACTTATCAGTGCCAATCACTGCTAAATCAGCTA
AAGATTTAACAATATTATATAAACATAATAAAGAAGTATCTCCACCAGAAGCAATAAATATATGTTTGAG
TTTATTTAAAAATAATAAATATGAAACTTACTACTCACAAGTTATATATAATTGGTTTGTATCTTCAGGA
TTATATTTATCACTTAGTGAAGGATCTATTTTTATAGATACAGACAGTAATAATTGTAGTAATTATGATA
AAGGTAAATTTTTAGGCGTAAATCTCGAACGTATAGCTGATGGCTGGGCTCCACCTCATTATGAAAAGAA
AATTACTATAAAATAG