SecReT6
Protein ID: 385793291
SecReT6 ID774
T6SS typeii
Gene symbol-
Locus tagFNFX1_1359
StrainFrancisella cf. novicida Fx1
Repliconchromosome [GenBank: NC_017450] [Browse all T6SS(s) in this replicon]
Location [Strand]1395401..1396597 [-]
Producthypothetical protein
NoteIglD
UniProt IDF4BCP3
KEGG IDfcf:FNFX1_1359
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.20E-05, Aligned region: 42..104
DUF876 [PF05936], Evalue: 5.20E-05, Aligned region: 185..345
Protein Sequence: 398 a.a.     [Download]
>gi|385793291|ref|YP_005826267.1| hypothetical protein [Francisella cf. novicida Fx1]
MFLERIYWEDGLRLDSDILDKSNLSVLERLSTASYLPANLNRGVVSFDLDTESLQTGLILIKDLKLYLDE
KNFVFYDKSYPLSLQIMTDKLSDEIPLFLNIREKVIEKNGVKYIYNQLSLSLEHSYGFKHSIQIALFRLD
RGRLVPEIYDFPLLTLNHYYLGDIFVKLNRTVSELKSFNRFVFSASRSYASILLVFLINKLERELKFAES
NRANSSPKQIFDLIHDIYSLIQLNLDKVEELDSIEFDFQKPLTKLNLLADRLLTLCEYRKINNFIRFELH
GKKYICESFPEEFFVASRYYLFLKRKATAPANVRFENKNALRITSISRNKNIVTLSLSGVKLVDVECSMI
NFTTRFDNIDAIYEIQKGSEWDFILADSSAVFTAFEGSENFDFFIAFS
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|385791932|ref|NC_017450.1|:c1396597-1395401 Francisella cf. novicida Fx1 chromosome, complete genome
ATGTTTCTAGAAAGGATTTATTGGGAAGATGGTTTAAGATTAGATAGCGATATTTTAGATAAATCAAATC
TATCTGTTTTAGAAAGGTTAAGCACTGCAAGCTATTTGCCAGCTAATCTTAATAGAGGAGTTGTTAGCTT
TGATTTAGATACTGAAAGTTTGCAGACAGGCCTTATCCTTATAAAAGATCTTAAATTGTACTTAGATGAA
AAAAATTTTGTTTTTTATGATAAGTCTTATCCGTTATCTTTACAAATAATGACTGATAAGTTAAGTGATG
AAATACCCTTATTTCTGAATATCAGAGAGAAAGTAATTGAAAAAAATGGGGTTAAATATATCTATAATCA
ATTGTCATTATCATTAGAGCATAGCTATGGTTTTAAACATAGCATCCAAATTGCATTATTTAGGTTAGAT
AGAGGGCGATTAGTACCAGAAATTTATGACTTTCCGCTATTAACTCTTAATCATTATTATTTAGGTGATA
TTTTTGTAAAACTTAATAGGACTGTTTCTGAACTAAAGTCTTTTAATCGCTTTGTTTTTTCAGCTTCAAG
ATCTTATGCGTCAATATTACTTGTATTTTTGATTAATAAATTAGAAAGAGAATTGAAGTTCGCGGAATCT
AATAGGGCAAATAGTTCCCCGAAACAAATATTTGATTTAATTCATGATATTTACAGCTTAATTCAACTTA
ACCTAGATAAAGTTGAAGAGCTTGATAGCATTGAATTTGATTTCCAAAAGCCTTTGACTAAATTAAATCT
ACTTGCTGATAGATTGTTAACTCTTTGTGAGTATAGAAAGATTAATAATTTTATCAGATTTGAATTGCAT
GGAAAAAAATATATATGTGAAAGCTTTCCTGAAGAGTTTTTTGTTGCTAGTAGATACTATCTTTTCCTTA
AAAGGAAAGCAACAGCTCCAGCCAATGTAAGGTTTGAAAATAAGAATGCTCTAAGAATTACTAGTATCAG
TAGAAATAAGAATATTGTAACTCTCTCTCTTTCAGGAGTAAAACTTGTTGACGTTGAATGTTCTATGATT
AATTTTACAACTAGATTTGATAATATCGATGCAATATATGAAATTCAAAAAGGTTCTGAGTGGGATTTTA
TATTAGCCGATAGTAGTGCGGTTTTTACGGCTTTTGAAGGTAGTGAGAATTTTGATTTCTTTATTGCCTT
TTCTTAA