SecReT6
Protein ID: 385793292
SecReT6 ID774
T6SS typeii
Gene symbol-
Locus tagFNFX1_1360
StrainFrancisella cf. novicida Fx1
Repliconchromosome [GenBank: NC_017450] [Browse all T6SS(s) in this replicon]
Location [Strand]1396618..1397247 [-]
Producthypothetical protein
NoteIglC
UniProt IDF4BCP4
KEGG IDfcf:FNFX1_1360
PDB IDNA
Domain hit(s) vs Pfam IglC [PF11550], Evalue: 1.10E-141, Aligned region: 1..209
Protein Sequence: 209 a.a.     [Download]
>gi|385793292|ref|YP_005826268.1| hypothetical protein [Francisella cf. novicida Fx1]
MSEMITRQQVTSGETIHVRTDPTACIGSHPNCRLFIDSLTIAGEKLDKNIVAIEGGEDVTKADSATAAAS
VIRLSITPGSINPTISITLGVLIKSNVRTKIEEKVSSILQASATDMKIKLGNSNKKQEYKTDEAWGIMID
LSNLELYPISAKAFSISIEPTELMGVSKDGMSYHIISIDGLTTSQGSLPVCCAASTDKGVAKIGYIAAA
 
Nucleotide Sequence: 630 bp     [Download]
>gi|385791932|ref|NC_017450.1|:c1397247-1396618 Francisella cf. novicida Fx1 chromosome, complete genome
ATGAGTGAAATGATAACAAGACAACAGGTAACAAGTGGCGAGACCATTCATGTGAGAACTGATCCTACCG
CATGTATAGGATCTCATCCTAATTGTAGATTATTTATTGATTCTTTAACTATAGCTGGGGAGAAACTTGA
TAAAAATATCGTTGCTATAGAGGGTGGAGAGGATGTCACGAAAGCTGATTCGGCTACAGCTGCTGCTAGT
GTAATACGTTTATCTATAACGCCAGGCTCTATAAATCCAACAATAAGTATTACTCTTGGTGTTCTAATTA
AATCAAATGTTAGAACTAAAATTGAAGAGAAAGTTTCGAGCATATTACAAGCAAGTGCTACAGATATGAA
AATTAAGTTAGGTAATTCTAATAAAAAACAAGAGTATAAAACTGATGAAGCATGGGGTATTATGATAGAT
CTATCTAATTTAGAGCTATATCCAATAAGTGCTAAGGCTTTTAGTATTAGTATAGAGCCAACAGAACTTA
TGGGTGTTTCAAAAGATGGAATGAGTTATCATATTATATCTATAGATGGTCTTACAACATCTCAAGGAAG
CTTGCCTGTATGTTGCGCAGCTAGCACAGATAAAGGAGTTGCTAAAATAGGATATATTGCAGCTGCATAG