SecReT6
Protein ID: 385793293
SecReT6 ID774
T6SS typeii
Gene symbol-
Locus tagFNFX1_1361
StrainFrancisella cf. novicida Fx1
Repliconchromosome [GenBank: NC_017450] [Browse all T6SS(s) in this replicon]
Location [Strand]1397265..1398785 [-]
Producthypothetical protein
NoteIglB
UniProt IDF4BCP5
KEGG IDfcf:FNFX1_1361
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-144, Aligned region: 73..497
Protein Sequence: 506 a.a.     [Download]
>gi|385793293|ref|YP_005826269.1| hypothetical protein [Francisella cf. novicida Fx1]
MTINKLSLTDELLNNFGGSTEVDSVLKNIDFDVSDDASKVLSLSTDYNARNLMALSLVLANNDNINNYNQ
KYIQKVITVIDKLIDLQVNSIISNDEFRALEQEWLKVQEVCQEDYDNVEVSILDVKKEELQYDFERNLYD
ISSSDFFKKVYVSEFDQYGGEPYGAILGLYNFENTTNDIIWLTGMGMVAKNSHAPFIASIDKSFFGVKDL
SEITHIKSFEALLEHPRYKEWNDFRNLDVAAYIGLTVGDFMLRQPYNPENNPVQYKLMEGFNEFVDYDKN
ESYLWGPASIHLVKNMMRSYDKTRWFQYIRGVESGGYVKNLVACVYDNKGILETKSPLNVLFADYMELSL
ANIGLIPFVSEKGTSNACFFSVNSAKKVEEFVDGFDSANSRLIANLSYTMCISRISHYIKCVIRDKIGSI
VDVESIQKILSDWISEFVTTVYQPTPLEMARYPFRNVSIEVKTIPGKPGWYSCKINVIPHIQFEGMNTTM
TIDTRLEPELFGTNNN
 
Nucleotide Sequence: 1521 bp     [Download]
>gi|385791932|ref|NC_017450.1|:c1398785-1397265 Francisella cf. novicida Fx1 chromosome, complete genome
ATGACAATAAATAAATTAAGTCTCACTGATGAACTTTTAAATAATTTTGGGGGATCTACAGAAGTTGATA
GTGTACTCAAAAATATAGATTTTGATGTTTCAGATGATGCTTCTAAAGTTTTATCTTTATCTACTGACTA
CAATGCTAGAAACCTTATGGCGCTATCTTTGGTATTAGCAAATAATGATAATATAAATAATTACAATCAA
AAATATATTCAAAAAGTTATTACAGTTATTGATAAGCTGATTGATTTACAAGTTAACTCTATTATATCTA
ATGATGAGTTTAGAGCACTTGAGCAAGAATGGCTAAAGGTGCAAGAGGTTTGTCAAGAAGACTATGATAA
TGTTGAAGTAAGTATATTAGATGTAAAAAAAGAAGAGCTACAATATGATTTCGAGAGAAATTTATATGAT
ATATCTAGTAGTGACTTTTTCAAAAAAGTATATGTTTCAGAATTTGATCAATATGGTGGCGAACCTTATG
GCGCAATATTAGGATTGTATAATTTTGAAAATACCACAAATGATATAATTTGGTTGACTGGAATGGGTAT
GGTGGCAAAGAATTCTCATGCACCATTTATTGCATCAATTGATAAGTCATTCTTTGGTGTTAAGGATTTA
TCAGAAATCACTCATATAAAAAGTTTTGAAGCTTTGCTTGAGCATCCTAGATATAAAGAGTGGAATGATT
TTAGAAACCTTGATGTTGCTGCATATATAGGTTTGACCGTGGGTGATTTTATGTTGCGGCAACCATATAA
TCCTGAGAATAATCCAGTTCAGTATAAGCTTATGGAAGGCTTTAATGAGTTTGTTGATTATGATAAGAAT
GAAAGTTATCTATGGGGACCTGCCTCAATTCATCTAGTTAAGAATATGATGAGATCTTATGATAAAACTA
GATGGTTCCAATATATAAGAGGAGTTGAGAGCGGTGGTTATGTAAAGAACTTGGTAGCTTGCGTATATGA
TAATAAAGGCATTCTAGAAACTAAGTCACCTCTAAATGTATTATTTGCTGATTATATGGAGTTATCACTT
GCAAATATTGGTTTAATACCATTTGTAAGTGAAAAAGGTACTAGTAACGCTTGTTTCTTTAGTGTAAATT
CTGCTAAAAAAGTCGAAGAATTTGTAGACGGATTTGACTCAGCAAACTCAAGATTAATTGCTAACCTTTC
TTACACTATGTGTATATCGAGAATATCTCATTATATTAAATGTGTAATTAGAGATAAGATTGGTAGTATT
GTGGATGTCGAGTCGATTCAAAAAATTCTTTCTGATTGGATATCAGAATTTGTCACCACAGTCTATCAAC
CAACCCCTTTAGAAATGGCGAGATATCCTTTCAGAAACGTTTCTATCGAGGTTAAAACCATACCGGGTAA
GCCTGGCTGGTATTCATGCAAAATAAATGTAATTCCCCACATTCAATTTGAAGGAATGAATACTACAATG
ACTATAGATACTAGGCTTGAACCAGAATTATTCGGTACAAATAATAACTAA