SecReT6
Protein ID: 385793294
SecReT6 ID774
T6SS typeii
Gene symbol-
Locus tagFNFX1_1362
StrainFrancisella cf. novicida Fx1
Repliconchromosome [GenBank: NC_017450] [Browse all T6SS(s) in this replicon]
Location [Strand]1398799..1399353 [-]
Producthypothetical protein
NoteIglA
UniProt IDF4BCP6
KEGG IDfcf:FNFX1_1362
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.50E-43, Aligned region: 4..156
Protein Sequence: 184 a.a.     [Download]
>gi|385793294|ref|YP_005826270.1| hypothetical protein [Francisella cf. novicida Fx1]
MAKNKIPNSRLMINYETNVDGVLKKKELPYRVLVVGDLSKGRSVDAKKEFADREVRRVNNGVDRVLEEMN
ISFDFEAPNFVSKDPSNLKVNYRIESVKDFRPDAVAKKVPEIRALLEMKEILASFAKDIENNRNLKKTID
MIFSDSNELESLKSKIPALTNYTIKDSCDAAESQDLSNQQVDDK
 
Nucleotide Sequence: 555 bp     [Download]
>gi|385791932|ref|NC_017450.1|:c1399353-1398799 Francisella cf. novicida Fx1 chromosome, complete genome
ATGGCAAAAAATAAAATCCCAAATTCAAGGTTGATGATAAATTATGAAACTAATGTTGATGGTGTCTTAA
AGAAAAAAGAGCTACCTTACAGAGTCCTAGTTGTTGGCGATTTATCAAAAGGAAGATCTGTGGATGCAAA
AAAAGAGTTCGCAGATAGAGAGGTCAGAAGAGTAAATAATGGTGTTGATAGGGTTTTAGAAGAGATGAAT
ATATCTTTTGATTTTGAGGCACCAAACTTTGTTTCTAAAGATCCTAGTAATTTAAAAGTTAATTATAGAA
TTGAAAGTGTCAAAGATTTTAGACCTGATGCTGTTGCTAAAAAAGTTCCTGAAATCAGAGCGCTGCTTGA
AATGAAAGAGATATTAGCATCGTTTGCTAAGGACATTGAAAATAATCGTAATCTCAAGAAAACCATAGAT
ATGATTTTTTCAGATAGTAACGAATTAGAATCATTAAAGAGTAAGATTCCTGCTTTGACAAATTATACGA
TTAAAGACTCTTGTGATGCTGCTGAGTCTCAAGACTTAAGTAATCAACAAGTAGATGATAAGTAG