SecReT6
Protein ID: 385793295
SecReT6 ID774
T6SS typeii
Gene symbol-
Locus tagFNFX1_1363
StrainFrancisella cf. novicida Fx1
Repliconchromosome [GenBank: NC_017450] [Browse all T6SS(s) in this replicon]
Location [Strand]1399434..1403171 [-]
Producthypothetical protein
NotePdpD
UniProt IDF4BCP7
KEGG IDfcf:FNFX1_1363
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1245 a.a.     [Download]
>gi|385793295|ref|YP_005826271.1| hypothetical protein [Francisella cf. novicida Fx1]
MDQDINDLLYDTDDLKKEKVNGGFFDFIKAWFYNDVERHMFFEDEIIVAQKLKTMDVMANTYALERKKYF
EKFLKDSHKQKGFFTRIKDRDFAFYKDPTRVKLWSSITDTDVYSFFIKSSVNQMLGGGNIAQLTSLPKFK
FNAIASVNSENISAAASLAATGEKSFLGSSCINVWSNLPVFDSERGDVKSFIPLYLRMSGKASSALFNYN
IDIGASTNKLKFTESKCMELLNNFKGNVNLRLVAAKSSREARSFIYTPKFKEDSNKHLNDLGFILNAQQG
SYRYLVPETRDGLDLIREYTYPEIEQIYFGRSALSGYSKSNYDKQSLGIEKNGEGLMTLRVSSKDYENPL
IQVKTSVNVTSFDLLSGEIKGKILADDLIGFSDAKGAINKFRNEVDTIIKNNISESFKSPFKIPNLSEFS
DMEIRVRFGLYSKQSASKLRTIRISIPMTTKMLDFNQTSGSYNTKPGMGYSMAQRHQLKEAIPYNEGLLE
NSAQRLFSGENLDFKNQLRSIAKDLTKDYVDFGNYAKDKANSLMENISNAAQQDFDLVKPTGNSTLGAVQ
DNLSNIYDKSSTFDSVIGSLRELYKLKGEDLTNIDSNDILNVLSQNSSLAELSGSVGADLNELKSKFKDI
ASIDIKKKASEAILSTSYQQYNPSFNKAKIFDNPDSFYVQDTLINYSQTLKKEQFRDQMSTINIIEFGSD
SDLPILFNLCKMMTSESAKADAKDFLSHKENASKTKEFIDALENTTSVISPESNISYTSINVLCSKNAGG
VITENNKASSVSLGSTISLADFNRMYSLDSRVSMLGVSPLEELSSFSAKKNEYKITFEEYFTKLVIQRYM
EVIMIDDEADFIKSFVSPMMECQKKLLDNLVILNKDAKWKSSSSFKSTFSSGSSFSFTGWLKERLPGFDF
ELSQEYAYFTGLVINFSIEEDNSSSETVIKLCKIIKSLDRLVRGFYFLLRRMVKNRNTKVGSHNVSESHI
NMVKQILTSLCEPYQILTQKVSDNAELLSALVNMLSFMDSLVEVQRLCASICIPTSAFFTLVNENKNLLK
DICYTVEKSGVTGIVVESTFSYSPELFKENQQDIKLNIKNTSVRVRDGKVKRVTSIDRNANTEAILQSIY
DNIIAFDEQDLERLFTGFRILKQENSTNTNKAVFNIGLTYHPITNNAFVEFNKDQQSLLYSYNNLSKDAY
VTKIKSIVDAKVALNLSFEHEEIRSSQGFSVLATVPARGYSIDDLNIKYRPIIWV
 
Nucleotide Sequence: 3738 bp     [Download]
>gi|385791932|ref|NC_017450.1|:c1403171-1399434 Francisella cf. novicida Fx1 chromosome, complete genome
ATGGATCAAGATATCAACGATTTATTATATGATACTGATGACCTCAAAAAAGAAAAAGTAAATGGAGGAT
TTTTTGATTTTATCAAAGCTTGGTTTTATAATGACGTTGAAAGACATATGTTTTTTGAAGATGAGATTAT
TGTAGCTCAGAAACTTAAAACGATGGATGTCATGGCTAATACATACGCCTTAGAGAGAAAAAAATATTTT
GAAAAATTTCTCAAAGATTCTCATAAACAAAAAGGTTTTTTTACAAGAATAAAAGATAGAGATTTTGCTT
TTTATAAAGATCCTACTAGGGTTAAACTATGGAGTAGTATTACTGATACGGATGTTTATAGCTTTTTTAT
AAAGTCAAGCGTTAATCAGATGCTTGGTGGTGGTAATATAGCTCAACTGACATCATTGCCAAAATTTAAG
TTTAATGCAATAGCATCAGTTAATAGTGAAAACATCTCTGCAGCAGCTAGTCTTGCAGCTACTGGAGAAA
AAAGTTTTTTGGGAAGTTCATGTATAAATGTTTGGTCTAATTTACCTGTATTTGATAGTGAAAGAGGAGA
TGTTAAATCATTTATTCCATTATACCTAAGAATGAGTGGTAAAGCTTCATCGGCATTATTTAATTATAAT
ATAGATATAGGTGCTAGCACAAATAAATTAAAATTTACTGAATCAAAATGCATGGAATTGTTAAATAACT
TTAAGGGTAATGTAAATCTTAGATTAGTAGCTGCAAAAAGCTCTAGAGAAGCAAGAAGCTTTATTTATAC
TCCAAAATTTAAAGAAGATAGTAATAAGCATTTAAATGATTTAGGTTTTATTCTAAATGCTCAGCAAGGT
TCATATAGATATTTAGTTCCTGAAACTAGGGATGGACTTGATCTAATTAGAGAATATACATACCCCGAAA
TTGAACAGATTTATTTTGGTAGGAGTGCACTTTCTGGTTATTCAAAAAGTAATTATGACAAGCAAAGTTT
AGGTATTGAGAAAAATGGTGAGGGTCTTATGACTCTTAGGGTTAGTTCCAAAGATTATGAAAATCCACTA
ATTCAGGTCAAAACTTCAGTTAATGTAACTAGTTTTGATCTTTTATCAGGAGAAATAAAAGGTAAGATTT
TAGCTGATGACTTAATTGGTTTTTCAGATGCTAAAGGTGCTATTAATAAGTTCAGAAACGAAGTTGATAC
AATTATTAAAAACAATATTAGTGAAAGCTTTAAGTCTCCTTTTAAGATACCAAACTTATCTGAATTTAGT
GATATGGAGATAAGAGTGAGGTTTGGCTTATATTCTAAACAATCAGCATCCAAGTTGAGGACCATAAGAA
TCTCTATTCCTATGACTACTAAAATGTTAGATTTTAATCAAACATCTGGGTCATATAATACAAAACCAGG
TATGGGTTATTCAATGGCTCAGAGACATCAATTAAAAGAAGCAATACCTTATAATGAAGGTCTTCTAGAA
AATTCTGCTCAGAGATTGTTTAGTGGTGAAAACTTAGATTTTAAAAACCAGTTGAGATCTATAGCTAAAG
ATCTGACGAAAGATTATGTCGATTTTGGTAATTATGCAAAAGATAAGGCTAACTCTTTGATGGAGAATAT
TTCAAATGCTGCTCAGCAGGATTTTGATTTGGTTAAACCAACCGGAAATAGTACTCTTGGAGCTGTGCAA
GATAATTTATCAAACATATATGATAAAAGTAGTACGTTTGACTCAGTAATAGGTTCTTTGAGAGAGCTTT
ATAAACTTAAAGGTGAAGACCTAACGAATATTGATTCTAATGATATCCTTAATGTTTTATCACAAAATTC
TTCTTTAGCAGAGTTATCTGGTAGTGTTGGGGCAGATCTAAATGAGCTAAAGTCTAAGTTTAAGGATATC
GCATCTATAGATATAAAGAAAAAAGCATCTGAAGCAATATTATCTACAAGTTATCAGCAATATAACCCTA
GTTTTAATAAGGCAAAAATATTCGATAACCCAGATTCTTTCTATGTTCAAGATACTTTAATTAACTACTC
ACAAACTCTAAAAAAAGAACAATTTAGAGATCAGATGTCGACAATAAATATTATTGAGTTTGGTAGTGAT
AGTGACTTACCTATATTATTTAATCTTTGTAAAATGATGACTAGTGAGTCAGCAAAAGCTGATGCTAAAG
ATTTTCTAAGCCACAAGGAAAATGCTAGTAAAACTAAAGAATTTATTGATGCTTTAGAAAATACCACTTC
TGTAATAAGTCCAGAATCAAATATCAGTTATACATCTATTAATGTGCTTTGTAGCAAAAATGCTGGAGGT
GTAATTACTGAGAATAACAAAGCATCTTCTGTATCCCTAGGTTCAACTATTAGTTTAGCGGATTTTAATA
GAATGTATTCGCTTGACTCAAGAGTTTCTATGCTTGGAGTATCTCCTTTAGAAGAGTTATCAAGTTTTTC
AGCGAAAAAAAATGAATATAAAATCACTTTTGAAGAATATTTTACTAAGTTAGTGATTCAAAGATATATG
GAAGTTATTATGATAGATGATGAAGCTGACTTTATAAAATCATTTGTATCACCAATGATGGAGTGTCAAA
AGAAACTATTAGATAATTTAGTTATTCTAAATAAGGATGCTAAATGGAAAAGTAGTTCATCATTTAAGAG
CACTTTCTCAAGTGGTAGTAGTTTTAGTTTTACTGGTTGGCTTAAAGAGAGACTTCCTGGCTTTGATTTT
GAACTTTCTCAGGAGTATGCTTATTTTACTGGTTTAGTAATAAACTTTTCAATTGAAGAAGATAATTCTT
CTTCTGAAACTGTAATTAAATTATGTAAGATTATAAAATCTTTAGATAGGCTTGTTCGAGGTTTTTATTT
CTTACTAAGAAGGATGGTGAAAAATAGAAATACTAAAGTTGGTTCTCATAATGTCTCTGAAAGTCACATT
AATATGGTTAAGCAGATTTTAACATCCTTATGTGAACCATATCAGATTTTAACTCAGAAGGTAAGCGATA
ATGCTGAACTGTTGTCTGCTTTAGTTAATATGTTGAGTTTTATGGATAGCCTTGTTGAAGTACAGCGGTT
ATGTGCTTCGATTTGTATTCCAACCAGTGCATTTTTCACTTTAGTGAATGAAAATAAAAATTTGTTGAAA
GATATTTGCTACACTGTCGAAAAAAGTGGTGTTACAGGAATAGTGGTTGAATCGACATTTAGCTATTCGC
CAGAACTCTTCAAAGAAAATCAACAAGATATTAAGCTTAACATCAAAAACACGTCAGTCAGAGTACGAGA
TGGTAAAGTCAAGAGGGTTACCAGCATTGATAGGAATGCTAATACTGAAGCTATCTTACAAAGTATTTAT
GATAATATAATTGCGTTTGATGAACAAGATTTAGAAAGACTATTTACGGGGTTTAGGATTTTAAAACAAG
AAAATTCGACAAACACTAATAAAGCCGTTTTCAATATTGGTTTAACATATCATCCAATAACTAATAATGC
TTTTGTTGAATTTAATAAGGATCAACAAAGTTTATTGTACTCATATAATAATTTAAGCAAAGATGCGTAT
GTCACAAAAATTAAAAGTATAGTTGATGCTAAAGTTGCTTTAAACCTTAGTTTTGAACATGAAGAGATTA
GAAGTTCACAAGGTTTTAGTGTCTTAGCAACTGTACCAGCTAGAGGATATTCTATAGATGATTTAAATAT
AAAGTATAGACCAATAATCTGGGTTTAA