SecReT6
Protein ID: 386016239
SecReT6 ID606
T6SS typei3
Gene symbol-
Locus tagPAJ_1649
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]1989056..1990684 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDF2EX21
KEGG IDpaj:PAJ_1649
PDB IDNA
Domain hit(s) vs Pfam Glucosaminidase [PF01832], Evalue: 4.50E-35, Aligned region: 404..537
Phage_base_V [PF04717], Evalue: 1.90E-24, Aligned region: 81..174
Phage_GPD [PF05954], Evalue: 0.00066, Aligned region: 2..43
Protein Sequence: 542 a.a.     [Download]
>gi|386016239|ref|YP_005934525.1| Rhs element Vgr protein, partial [Pantoea ananatis AJ13355]
MVSGSGTATGIAPGYTFALLNAPHFSDNGKYLVTSAHYDFEENSYASGDVGATRHNIDFTVLPAAVTYRA
KPETPWPKTHGPQTAKVVGPKGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGFGGVQIP
RVNDEVVVDFINGDPDRPLIIGRVYNEASMPPWALPAAATQMGFLSRSKDGTADTANALRFEDKAGEEHL
WIQAQKNMDTHVKNDSSHSVANNHSHYAGGNELYRVETNRVHGVKGGEERLTGQGKIDNVVDTYVLGSGT
KLRLECGESAIELNANGHINIVGKGFNLFVNGDGHITTSGGKLNLNTSGAQPGTGAPGAGHKGNINQAVV
NLFPPKQKGQAAPAAPKAKVEHAKSPSTPVNNKTEKKVRPLPPEKQAFFDKVYAAAQADEKKTGVPAQVT
TAQAILESDWGKRVPTDVNTNKVSNNLFGVKAHGSPNYVESWTHENINGKRVPVLDKFASYDSVDESIEQ
HSQFLIKNQRYSSLFQSSDPVEWAKGLQDKGYATDPNYAKSLISVMKGRGLL
 
Nucleotide Sequence: 1629 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c1990684-1989056 Pantoea ananatis AJ13355, complete genome
ATGGTGAGCGGGAGCGGCACGGCGACGGGCATCGCGCCGGGCTACACTTTCGCGCTGCTGAACGCACCGC
ACTTCAGCGACAACGGCAAATACCTGGTGACGTCGGCGCACTACGACTTTGAAGAGAACAGCTACGCGAG
CGGCGACGTGGGCGCCACGCGGCACAACATCGACTTCACGGTGCTGCCGGCGGCGGTGACGTACCGTGCG
AAGCCGGAGACGCCGTGGCCGAAGACACACGGCCCGCAGACGGCGAAGGTGGTGGGGCCGAAAGGCGAGA
GTATCTGGACGGACAAATACGGCCGGGTGAAGGTGAAGTTCCACTGGGACCGTCTGGCGAAGGGCGACGA
CACGAGTTCGTGCTGGGTGCGCGTATCGAGTGCCTGGGCGGGCCAGGGCTTCGGCGGGGTGCAGATCCCG
CGCGTCAACGATGAGGTCGTCGTGGACTTCATCAACGGCGATCCAGACCGTCCGTTGATCATTGGCCGCG
TTTATAACGAAGCCAGTATGCCGCCATGGGCACTACCGGCTGCCGCCACACAAATGGGCTTTCTGAGTCG
CTCGAAAGACGGCACTGCGGATACCGCGAACGCATTACGCTTTGAGGATAAGGCGGGCGAGGAGCATTTG
TGGATCCAGGCGCAGAAGAACATGGATACGCATGTTAAAAATGATTCCAGCCATTCCGTTGCCAACAACC
ACAGCCACTATGCAGGCGGTAACGAACTCTATCGCGTTGAAACCAACCGTGTACATGGCGTGAAAGGTGG
AGAAGAGCGTTTAACGGGACAAGGGAAAATCGACAATGTTGTTGATACCTATGTACTGGGCTCAGGTACT
AAGTTACGGCTTGAATGTGGCGAAAGCGCTATTGAACTTAATGCTAATGGTCATATCAATATTGTCGGTA
AGGGCTTCAATCTGTTTGTAAACGGTGATGGACACATCACTACATCAGGCGGAAAACTTAATTTAAATAC
ATCCGGTGCGCAGCCGGGTACGGGTGCACCTGGTGCTGGCCACAAAGGCAACATCAATCAGGCCGTTGTG
AATCTTTTCCCCCCAAAGCAAAAGGGGCAGGCGGCCCCGGCAGCACCTAAAGCGAAGGTTGAGCATGCGA
AATCCCCTTCCACACCAGTAAACAATAAAACTGAAAAGAAAGTGCGGCCGTTACCTCCCGAAAAACAAGC
CTTTTTTGATAAGGTGTACGCCGCAGCTCAAGCTGATGAGAAAAAGACAGGCGTCCCTGCACAGGTAACA
ACTGCTCAAGCCATATTGGAATCTGACTGGGGAAAGAGAGTGCCGACTGACGTTAATACCAATAAGGTCA
GTAATAATCTTTTTGGGGTAAAAGCACACGGCTCGCCAAATTATGTGGAATCATGGACTCATGAAAACAT
AAATGGCAAACGAGTACCTGTTTTAGACAAATTCGCGAGTTATGACTCAGTAGATGAAAGTATTGAACAG
CATTCTCAATTTTTGATTAAAAATCAGAGGTATAGTAGTTTGTTTCAGTCATCGGATCCTGTTGAGTGGG
CCAAAGGATTACAGGATAAAGGCTATGCAACGGATCCCAACTATGCTAAAAGCTTGATTTCAGTAATGAA
AGGTAGAGGCCTCCTATGA