SecReT6
Protein ID: 386016240
SecReT6 ID606
T6SS typei3
Gene symbol-
Locus tagPAJ_1650
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]1990563..1991252 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDF2EX22
KEGG IDpaj:PAJ_1650
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-43, Aligned region: 3..196
Protein Sequence: 229 a.a.     [Download]
>gi|386016240|ref|YP_005934526.1| Rhs element Vgr protein, partial [Pantoea ananatis AJ13355]
MKRDRNLRIFQSQTVPQIVQTLLKEYGVNVETRLAGSYRVWEYCVQYQESSFDFISRLMELEGMYYFFRH
EADKHTLVLCDAPDQHQAFPGYETIAYHVTPSGGSVTEEGVSQWALSESVTPGMYSTDDYDFRKPNAWML
QARQNPVSPTPGVRWTVYRLARVSFSGSTGHRQNTTQQYPPGGVAGGAPHGERERHGDGHRAGLHFRAAE
RTALQRQRQIPGDVGALRL
 
Nucleotide Sequence: 690 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c1991252-1990563 Pantoea ananatis AJ13355, complete genome
ATGAAGCGCGACCGCAACCTGCGCATCTTCCAGAGCCAGACGGTGCCGCAGATTGTGCAGACGCTGCTGA
AGGAGTACGGAGTGAACGTGGAAACGCGCCTGGCGGGAAGCTACCGGGTGTGGGAATACTGCGTGCAGTA
TCAGGAGAGCAGCTTCGACTTTATCAGCCGGCTGATGGAGCTGGAGGGGATGTACTACTTCTTCCGGCAC
GAGGCGGACAAGCACACGCTGGTGCTGTGCGACGCGCCGGACCAGCACCAGGCGTTCCCGGGCTACGAGA
CGATAGCCTACCACGTGACGCCGTCGGGCGGCAGCGTGACGGAAGAGGGCGTGAGCCAGTGGGCGCTGTC
GGAAAGCGTGACGCCGGGGATGTACAGCACGGACGACTACGACTTCCGCAAGCCGAACGCGTGGATGCTG
CAGGCGCGGCAGAACCCGGTGTCGCCGACCCCAGGGGTCAGGTGGACAGTGTACAGACTGGCCAGGGTCA
GCTTCAGTGGAAGCACAGGTCACAGGCAGAATACTACGCAGCAGTATCCGCCAGGAGGTGTGGCAGGTGG
AGCACCACATGGTGAGCGGGAGCGGCACGGCGACGGGCATCGCGCCGGGCTACACTTTCGCGCTGCTGAA
CGCACCGCACTTCAGCGACAACGGCAAATACCTGGTGACGTCGGCGCACTACGACTTTGA