SecReT6
Protein ID: 386016244
SecReT6 ID606
T6SS typei3
Gene symbol-
Locus tagPAJ_1654
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]1998701..2000764 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDF2EX26
KEGG IDpaj:PAJ_1654
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.60E-74, Aligned region: 25..332
Phage_base_V [PF04717], Evalue: 1.10E-25, Aligned region: 370..463
Protein Sequence: 687 a.a.     [Download]
>gi|386016244|ref|YP_005934530.1| Rhs element Vgr protein [Pantoea ananatis AJ13355]
MSMFSRITVQLPAQGLLFRRLSGSEALSQSFVLQAELLSTDARIDRKSLLGKPVTFTLPTDGLLSAVNPR
YINGKITQIGVRSEELGGVRYAVYGLTVESDLWPMKRDRNLRIFQSQTVPQIVQTLLKEYGVNVETRLAG
SYRVWEYCVQYQESSFDFISRLMELEGMYYFFRHEADKHTLVLCDAPDQHQPFPGYETIAYHVTPSGGSV
TEEGVSQWALSESVTPGMYSTDDYDFRKPNAWMLQARQNPVSPTPGSVDVYDWPGRFVEHGHGEYYARIR
QEVWQVEHHMVSGSGTATGIAPGYTFSLLNAPHFSDNGKYLVTSAHYDFEENSYASGDAGATRHNIDFTV
LPAAVTYRAKPETPWPRTHGPQTAKVVGPKGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAG
QGFGGVQIPRVGDEVVVDFINGDPDRPIVTGRVYNEASMPPWDLPGDATRMGFMTRSKDGHQANASYLFF
EDKPGGELLNMHAEKDMNISVENDKTVAIDGSRTTTIGKEQNDEVTGDATFHYKQKRTTTVDQLESNIFN
NGESTEIKNGRKLNLKSGGDESNITGGQKLNLNGTREVTISNGDILNVQAEGRKQHINGNVEEEINGNVG
VNINGNWTQTVEGGTAFISSPNLIRIQSATKVEIDSPQGLYTNKGLNVSFNGASNVI
 
Nucleotide Sequence: 2064 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c2000764-1998701 Pantoea ananatis AJ13355, complete genome
ATGTCTATGTTCTCACGTATTACTGTACAACTTCCCGCACAAGGACTGCTGTTCCGACGTCTGAGCGGCA
GCGAAGCGCTGTCCCAGTCGTTCGTGCTGCAAGCGGAGCTGCTCTCCACCGACGCGCGCATTGATCGTAA
GTCGTTGCTGGGCAAGCCGGTCACTTTCACGCTGCCGACGGACGGTCTGCTGAGCGCGGTGAACCCGCGC
TACATCAACGGCAAAATTACGCAGATAGGCGTGCGCAGCGAGGAGCTGGGCGGCGTGCGCTACGCGGTGT
ACGGGCTGACGGTGGAGTCGGATCTGTGGCCGATGAAGCGCGACCGCAACCTGCGCATCTTCCAGAGCCA
GACGGTGCCGCAGATTGTGCAGACGCTGCTGAAGGAGTACGGAGTGAACGTGGAAACGCGCCTGGCGGGA
AGCTACCGGGTGTGGGAATACTGCGTGCAGTATCAGGAGAGCAGCTTCGACTTTATCAGCCGGCTGATGG
AGCTGGAGGGGATGTACTACTTCTTCCGGCACGAGGCGGACAAGCACACGCTGGTGCTGTGCGACGCCCC
GGACCAGCACCAGCCGTTCCCGGGTTACGAGACGATAGCCTACCACGTGACGCCGTCGGGCGGCAGCGTG
ACGGAAGAGGGCGTGAGCCAGTGGGCGCTGTCGGAAAGCGTGACGCCGGGGATGTACAGCACGGACGACT
ACGACTTCCGCAAGCCGAACGCGTGGATGCTGCAGGCGCGGCAGAACCCGGTGTCGCCGACCCCGGGGTC
GGTGGACGTGTACGACTGGCCGGGTCGCTTCGTGGAGCACGGTCACGGCGAATACTACGCGCGTATCCGC
CAGGAGGTGTGGCAGGTCGAGCACCACATGGTGAGCGGGAGCGGCACGGCGACGGGCATCGCGCCGGGGT
ACACCTTTTCGCTGCTGAACGCGCCGCACTTCAGCGACAACGGCAAATACCTGGTGACGTCGGCGCACTA
CGACTTTGAAGAGAACAGCTACGCGAGCGGCGACGCGGGCGCCACGCGGCACAACATCGACTTCACGGTG
CTGCCGGCGGCGGTTACTTACCGTGCGAAGCCGGAGACGCCGTGGCCGAGGACGCACGGCCCGCAGACGG
CGAAGGTGGTGGGGCCGAAAGGCGAGAGCATCTGGACGGACAAATACGGCCGGGTGAAGGTGAAGTTCCA
CTGGGACCGTCTGGCGAAGGGCGACGACACGAGTTCGTGCTGGGTGCGCGTATCGAGCGCCTGGGCGGGC
CAGGGCTTCGGCGGGGTGCAGATCCCGCGCGTGGGCGATGAGGTCGTCGTCGATTTTATCAACGGCGATC
CGGACCGGCCAATCGTCACCGGGCGTGTCTACAACGAAGCCAGCATGCCACCCTGGGATCTCCCCGGCGA
TGCTACACGAATGGGCTTTATGACACGGAGTAAAGACGGACATCAGGCCAATGCCAGCTATCTGTTCTTT
GAAGATAAGCCGGGCGGTGAACTGCTGAATATGCATGCTGAGAAAGACATGAATATTTCGGTGGAGAATG
ATAAGACCGTTGCCATTGATGGATCCCGGACTACCACTATTGGAAAAGAGCAGAATGACGAAGTAACAGG
TGATGCGACTTTTCATTATAAACAGAAGCGGACTACTACGGTTGACCAACTTGAGTCGAATATATTCAAT
AATGGTGAAAGTACAGAGATTAAAAACGGGCGAAAGCTAAATTTAAAAAGTGGAGGCGACGAGAGCAATA
TTACGGGTGGACAAAAACTCAATCTTAACGGCACTAGGGAAGTCACTATATCAAACGGTGATATCCTTAA
TGTTCAGGCTGAGGGGCGGAAGCAACATATAAATGGCAATGTTGAGGAGGAAATAAATGGCAATGTCGGA
GTGAATATAAATGGCAACTGGACTCAGACGGTTGAAGGCGGGACTGCATTTATCTCATCTCCAAATTTAA
TAAGAATTCAAAGTGCGACAAAGGTAGAAATTGATTCACCGCAAGGGCTTTATACTAATAAAGGTTTAAA
TGTCTCTTTTAATGGAGCATCAAATGTCATTTAA