SecReT6
Protein ID: 386016247
SecReT6 ID606
T6SS typei3
Gene symbol-
Locus tagPAJ_1657
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]2004926..2005975 [-]
Producthypothetical protein
NoteTssG
UniProt IDF2EX29
KEGG IDpaj:PAJ_1657
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.80E-107, Aligned region: 26..330
Protein Sequence: 349 a.a.     [Download]
>gi|386016247|ref|YP_005934533.1| hypothetical protein PAJ_1657 [Pantoea ananatis AJ13355]
MSETAHVIPLQRAVRLPDGFWQAVMAAPWRYDLFQLLRKLDAQSGQRYALGKAPLPKFEAVRLGQKPSLA
FAPSTVSQVKAREQDERYDVSIYSFGLFGPNGPLPTHLTEYVRGRIDHHQDHSLSAFADLFHHRATLLFY
RAWANSQPTSSLDRRDDRRFQDYLACVAGIGLPAQQKASSLSLHARLMLSGHLSRHGHDAEGLVRILRHY
FAVPVKLQQNVPQWLSLDSRDQARLSAGRHMPRLGESAFLGVAVRDVQHRFRLRIGPLSAEQYERFLPNA
QGACEVRDWVRHYLGIEMQWDLSLILAADAVKGVTLGGQARLGYTSWLGQQPQPVDREDFAFEVEATPS
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c2005975-2004926 Pantoea ananatis AJ13355, complete genome
ATGAGTGAGACGGCGCACGTTATTCCCCTACAGCGGGCGGTGCGTCTGCCTGACGGTTTCTGGCAGGCCG
TGATGGCCGCGCCCTGGCGCTATGATCTGTTTCAGCTGTTACGCAAGCTGGACGCCCAGAGTGGGCAGCG
TTATGCCTTAGGTAAAGCGCCACTGCCCAAATTTGAGGCCGTGCGTCTTGGGCAAAAGCCATCCCTGGCC
TTTGCACCGTCGACCGTGTCACAGGTTAAAGCGCGTGAGCAGGACGAACGCTACGACGTCTCCATTTACA
GCTTTGGGCTGTTTGGTCCCAACGGTCCTCTCCCTACGCACCTGACGGAATATGTACGCGGACGTATCGA
TCACCATCAGGATCACAGCCTGAGCGCTTTCGCCGATCTGTTTCATCATCGTGCCACGCTGCTGTTCTAC
CGTGCCTGGGCTAATTCACAGCCAACCAGCTCCCTGGATCGCCGCGACGATCGGCGGTTTCAGGATTATC
TGGCCTGCGTGGCCGGTATTGGGTTACCGGCCCAGCAGAAAGCCAGTTCGCTGAGTCTGCATGCGCGCCT
CATGCTGTCAGGGCATCTCAGCCGCCACGGTCACGATGCCGAAGGGCTGGTACGCATTTTGCGTCACTAC
TTTGCCGTTCCGGTTAAGCTGCAACAGAACGTGCCGCAGTGGTTGTCCCTGGACAGCCGCGATCAGGCCC
GTCTGTCGGCCGGTCGCCATATGCCGCGCCTGGGTGAATCGGCCTTTCTCGGTGTGGCCGTTCGTGATGT
ACAGCATCGTTTTCGTCTGCGTATCGGTCCACTGAGCGCCGAGCAGTACGAACGTTTTTTACCCAACGCG
CAGGGCGCTTGCGAAGTGCGTGACTGGGTGCGCCACTATCTGGGTATTGAGATGCAGTGGGATCTCAGCC
TGATTCTGGCAGCCGATGCCGTTAAGGGCGTAACCCTTGGCGGTCAGGCGCGGCTGGGCTACACCAGTTG
GCTTGGACAGCAACCTCAGCCTGTCGATCGTGAAGATTTTGCCTTTGAGGTTGAAGCTACGCCGTCATAG