SecReT6
Protein ID: 386016248
SecReT6 ID606
T6SS typei3
Gene symbol-
Locus tagPAJ_1658
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]2005972..2007849 [-]
Producthypothetical protein
NoteTssF
UniProt IDF2EX30
KEGG IDpaj:PAJ_1658
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-211, Aligned region: 5..625
Protein Sequence: 625 a.a.     [Download]
>gi|386016248|ref|YP_005934534.1| hypothetical protein PAJ_1658 [Pantoea ananatis AJ13355]
MDSKLLDYYNRELAYLREMGAEFAAQYPKVAGRLGMRGIDVADPYVERLMEGFAFLTSRVQLKMDAEFPR
FSQRMLEMVAPGYLSPTPSMAIAQLTPDSRKGDISNGFLVPRGTMMESQNLKKTGVTCSYTTAHDVMLQP
LRISDVSLGGVPADIPLGELKAGGSTAASSALRIRITCEGISSLSQLSLDDVMFFLSGPDIQALKLMELL
MQHRVGIILQSVEAKPQRQVLPDDALQQEGFSTEQALLPDDLRNFDGYRLLQEYFAFPARFQFISLRQLA
PFLQRCDNALSFDIVILLDKADAALESVVDSAHLALHCTPVINLFPKTAERLKVSDSQHEYHLVVDNIRP
LDYEIHSVKRLFASVEGQREEQIFRPFWSTFSHDGGDYGAYFSLRREQRTLSEHALRYGTRTGYIGSEVF
LSLVDQNHTPWNSDIRYLSAEVMCTSRDLPLMLLQQEQANFVMPDSIPVGQLKLCKGPTPPRPALAEGLS
AWRLISHLQMNYLSLMDSSDGEGAAALRQMLSLYASLAETPLTRQIDGIRHCNLKAVHRRVPEPGPVVFA
RGVSIALEVDEQAFSGASPWLFGSVLERVFSRLVALNSFTEFTLSSQQRGEVGYWPPRMGKKALL
 
Nucleotide Sequence: 1878 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c2007849-2005972 Pantoea ananatis AJ13355, complete genome
ATGGACAGCAAGCTGCTTGATTACTACAACCGTGAACTGGCCTATCTGCGCGAGATGGGCGCGGAGTTTG
CTGCCCAGTATCCCAAGGTCGCCGGGCGGCTTGGTATGCGCGGCATTGACGTCGCCGATCCTTACGTCGA
AAGACTTATGGAGGGTTTCGCGTTTCTGACGTCACGCGTGCAGTTAAAGATGGATGCCGAGTTTCCACGC
TTTTCTCAGCGGATGCTGGAAATGGTGGCACCGGGCTACCTTTCACCTACGCCGTCGATGGCCATCGCCC
AGCTCACGCCGGACAGCCGCAAAGGCGATATCAGCAACGGTTTCTTAGTGCCGCGCGGCACAATGATGGA
AAGCCAGAACCTGAAAAAAACGGGCGTCACCTGCAGCTATACCACCGCGCACGATGTGATGTTACAGCCC
CTGCGTATCAGCGATGTGTCGTTAGGTGGCGTGCCAGCGGATATCCCGTTAGGCGAGTTGAAAGCGGGCG
GCTCGACGGCGGCGTCCAGCGCCCTCCGTATCCGCATCACCTGCGAAGGCATTTCATCGTTAAGCCAGCT
CAGTCTCGATGACGTGATGTTTTTCCTGAGCGGACCCGACATCCAGGCCCTGAAACTGATGGAGCTGCTG
ATGCAGCATCGTGTCGGAATCATCCTGCAGTCCGTGGAAGCAAAACCGCAACGTCAGGTTCTGCCGGATG
ACGCGCTTCAACAGGAAGGCTTTTCGACCGAGCAGGCCCTGCTGCCCGACGATCTGCGTAATTTTGACGG
CTACCGCCTGCTGCAGGAGTATTTTGCATTCCCGGCACGCTTCCAGTTTATCAGCCTGCGTCAGCTGGCG
CCTTTCCTGCAGCGCTGCGATAACGCCCTGTCGTTTGACATCGTCATCCTGCTGGATAAGGCCGATGCGG
CGCTGGAAAGCGTTGTCGACAGCGCCCATCTGGCCCTGCACTGCACGCCGGTCATTAACCTGTTCCCGAA
AACCGCCGAGCGGCTTAAGGTCAGTGACAGTCAGCACGAGTATCACCTGGTGGTCGATAACATTCGTCCG
CTGGACTATGAGATCCATTCGGTGAAGCGCTTGTTCGCCTCTGTCGAAGGGCAGCGCGAAGAGCAGATCT
TCCGGCCGTTCTGGAGCACCTTCAGCCATGACGGCGGGGATTATGGCGCGTATTTCTCCCTGCGTCGTGA
ACAGCGCACGCTCTCTGAGCACGCGTTGCGCTATGGCACCCGAACGGGCTATATCGGTTCTGAAGTGTTT
CTCTCCCTGGTGGATCAAAATCATACACCGTGGAACAGCGATATCCGCTACTTGTCTGCGGAAGTGATGT
GCACCAGCCGTGACCTGCCTTTGATGCTGCTACAGCAAGAGCAGGCCAACTTTGTGATGCCGGATTCCAT
CCCTGTCGGGCAACTTAAATTGTGCAAAGGCCCGACGCCACCGCGTCCGGCGCTGGCTGAAGGGCTTTCA
GCATGGCGACTCATCAGTCATCTGCAGATGAACTATCTAAGCCTGATGGACAGCAGCGATGGCGAAGGGG
CTGCGGCACTGCGCCAGATGCTGAGCCTGTACGCCAGCCTGGCCGAAACGCCGCTAACGCGTCAGATTGA
CGGAATTCGGCACTGCAACCTCAAAGCCGTTCACCGTCGGGTGCCCGAGCCGGGCCCCGTGGTGTTTGCG
CGCGGGGTTAGCATTGCGCTTGAGGTGGATGAGCAGGCGTTTTCAGGTGCCAGCCCCTGGCTGTTCGGCA
GCGTGCTGGAGCGGGTCTTTTCTCGCCTTGTGGCGCTTAACAGCTTTACCGAATTCACCCTGAGCAGCCA
GCAGCGCGGCGAAGTGGGCTACTGGCCGCCGCGCATGGGCAAAAAGGCGCTGCTATGA