SecReT6
Protein ID: 386016249
SecReT6 ID606
T6SS typei3
Gene symbol-
Locus tagPAJ_1659
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]2007852..2008427 [-]
Producthypothetical protein
NoteTssE
UniProt IDF2EX31
KEGG IDpaj:PAJ_1659
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.20E-19, Aligned region: 60..170
Protein Sequence: 191 a.a.     [Download]
>gi|386016249|ref|YP_005934535.1| hypothetical protein PAJ_1659 [Pantoea ananatis AJ13355]
MSRNDNSSGDGYSQLHGGYRARKNRDTLTARDKLQSSLLDRLTDDAPDKTTESGNSSIITHSTLRRNVLR
DLQWLFNTINNEAQHDLSDLTEVQRSVLNFGVAPLAGQNISDIEWQDMQRKMTDAILHFEPRILPQGLQV
RCVSDLTSLSLHNVLSIEIKGRLWCVPYPLEFLFRTQVDLESGHFELQDAG
 
Nucleotide Sequence: 576 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c2008427-2007852 Pantoea ananatis AJ13355, complete genome
ATGAGTCGTAATGACAATTCGTCCGGTGACGGCTATTCGCAGCTGCATGGCGGCTATCGTGCGCGCAAAA
ATCGCGACACGCTGACGGCGCGTGACAAACTGCAGTCGTCCCTGCTGGACAGGCTGACAGACGACGCGCC
AGATAAAACCACCGAGTCAGGCAACAGTTCGATTATTACCCACAGTACGCTGCGACGTAATGTTCTGCGC
GATCTCCAGTGGTTATTCAACACCATCAATAACGAGGCGCAGCACGATCTGAGCGACCTGACGGAGGTCC
AGCGTTCCGTGCTGAATTTTGGCGTGGCCCCCCTGGCCGGACAGAATATCTCGGACATCGAGTGGCAGGA
TATGCAACGGAAAATGACCGATGCCATTCTGCACTTTGAGCCACGCATTTTACCCCAGGGCTTACAGGTT
CGCTGCGTAAGCGACCTGACCTCTCTGAGTCTGCACAACGTACTATCGATTGAGATTAAAGGCCGGTTAT
GGTGCGTGCCGTACCCGCTGGAGTTTCTGTTCCGCACTCAGGTTGATTTAGAGAGCGGCCATTTTGAACT
ACAGGATGCAGGTTAA