SecReT6
Protein ID: 386016250
SecReT6 ID606
T6SS typei3
Gene symbol-
Locus tagPAJ_1660
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]2008417..2009244 [-]
Producthypothetical protein
NoteTagJ
UniProt IDF2EX32
KEGG IDpaj:PAJ_1660
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 3.90E-41, Aligned region: 144..265
Protein Sequence: 275 a.a.     [Download]
>gi|386016250|ref|YP_005934536.1| hypothetical protein PAJ_1660 [Pantoea ananatis AJ13355]
MDSLQQRLANATLAENLSSITAQIQANPADADLRAAFVQLLCLDGNWSRAQTQLKSWLAMLPQAQPTVTL
LQQAIEGEQKRAAVLRGEAEPQLPGSAWPWCQVLLAALKADIAGDKAVGAALRAQALESAEASAGTATTQ
EGESPFAWIMDGDSRFGPVCEAIANGHYYWIPFAAISEIEFQAPASVTDLVWRHTRLQLVDGSEQICQIP
VRYPLQDKADERFLRASVTEWQESGSDDGQFIGHGQKMWLSDEADYPLLTLQQLIFNETELPHES
 
Nucleotide Sequence: 828 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c2009244-2008417 Pantoea ananatis AJ13355, complete genome
ATGGACTCATTACAACAGCGACTGGCCAATGCTACCCTGGCGGAAAACCTGTCCAGCATCACTGCACAAA
TCCAGGCGAATCCGGCTGATGCGGATTTACGGGCGGCATTTGTGCAACTCCTGTGCCTTGACGGTAACTG
GAGCAGGGCGCAGACACAGCTGAAATCCTGGCTGGCCATGCTGCCTCAGGCGCAGCCCACCGTGACCTTG
CTGCAACAGGCTATTGAGGGCGAACAGAAACGTGCAGCGGTTTTGCGCGGTGAAGCCGAGCCGCAACTGC
CAGGAAGCGCCTGGCCGTGGTGCCAGGTCTTACTGGCCGCGCTGAAAGCGGACATAGCGGGCGATAAGGC
CGTCGGTGCGGCACTGCGTGCTCAGGCGCTGGAAAGCGCAGAGGCGAGCGCCGGTACGGCCACAACCCAG
GAGGGGGAAAGCCCGTTCGCCTGGATAATGGACGGTGACAGCCGCTTCGGACCGGTCTGTGAAGCCATCG
CCAATGGACACTATTACTGGATCCCGTTTGCTGCCATCAGCGAAATAGAGTTTCAGGCTCCGGCAAGCGT
CACGGATCTGGTCTGGCGCCATACTCGCCTGCAGCTGGTGGACGGAAGTGAGCAAATTTGTCAGATTCCG
GTGCGCTACCCGCTTCAGGACAAGGCTGATGAACGCTTCCTGCGGGCAAGCGTAACGGAGTGGCAGGAAT
CAGGCAGCGATGACGGTCAGTTTATCGGTCACGGGCAAAAGATGTGGCTCAGCGATGAAGCAGATTATCC
CTTACTGACGCTGCAGCAGCTTATTTTCAACGAAACTGAGTTACCTCATGAGTCGTAA