SecReT6
Protein ID: 386016253
SecReT6 ID606
T6SS typei3
Gene symbol-
Locus tagPAJ_1663
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]2011073..2012968 [-]
ProductFHA domain containing protein
NoteFha
UniProt IDF2EX35
KEGG IDpaj:PAJ_1663
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.80E-07, Aligned region: 27..93
UreE_N [PF02814], Evalue: 0.0013, Aligned region: 32..49
UreE_N [PF02814], Evalue: 0.0013, Aligned region: 78..99
Protein Sequence: 631 a.a.     [Download]
>gi|386016253|ref|YP_005934539.1| FHA domain containing protein [Pantoea ananatis AJ13355]
MRFTIITAKPGHEPPQISFDFLPPGGTIGRGVDNNLILPDDDRTISRLQAIVHITAEGECRLTNRGNVTR
VLLNDIPLERGRQVELQDGDILGIDDYRLLVNDLNGEQQSQQPPLTAAAAPKPQPVPNAVPVQAPAASTA
AIPSEIWDSLAKEFSISDDLSKRKSAAPEMPEANPLTSTAANRNPEDPLAQLMSDKPLDIGQQPKTSSLF
DEEDALFAQESIFDDRTPSTLSAKQNAQGQPKIEETSTDVDPLNLFGSQTTPDPRHHDDPLGLMMSGAVP
LAQPDMPVSQPVAAPSQPKENHQSAPLQQKELHQAAPLQPQENHQPMPDILDTAPVELADLSSSPLFDHT
ETQVTHDPAFDPQPQPAQPEGAQSPIDYGGITLPTPQAVQRTPSPTPKGRLRIDPVASHNNSGGTEQSGN
ASSGDALKGELLDALLEGMGLQDLQPTPQFDREQMRQFGQMLSMFSQGTVALLSSRSILKRGVKADMTVI
LDDANNPFKLLPSGKTVLMQMFGSRMPGFMPPRQAVRDALIDLQAHQLGMIAGIRAIIASMLQSFNPDQL
EEEARQNGSVSRIGLPGSRKAALWEHFIQRYGETAGEIEDDFHTLFGEAFLHAYDMEVNQYKDSQTHTDD
A
 
Nucleotide Sequence: 1896 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c2012968-2011073 Pantoea ananatis AJ13355, complete genome
ATGCGCTTTACGATAATAACCGCTAAACCCGGCCATGAACCGCCGCAAATCAGTTTCGATTTTCTTCCTC
CAGGCGGCACTATTGGTCGAGGCGTGGATAATAATCTGATATTGCCCGACGACGATCGCACTATTTCTCG
CCTGCAGGCTATCGTGCATATTACTGCAGAGGGTGAATGTCGCCTGACCAACCGCGGTAACGTTACGCGC
GTGCTGCTGAATGACATCCCGCTTGAACGTGGACGTCAGGTGGAGTTGCAGGACGGAGATATTCTCGGCA
TCGACGACTATCGCCTGCTGGTTAACGATCTTAATGGCGAGCAGCAATCGCAGCAGCCTCCGTTGACCGC
TGCAGCCGCACCTAAGCCGCAGCCCGTACCCAATGCGGTCCCTGTACAGGCGCCGGCTGCCAGCACGGCT
GCCATTCCCAGCGAGATCTGGGACAGCCTTGCCAAAGAGTTTTCAATTTCTGATGATTTATCGAAACGTA
AAAGTGCTGCGCCAGAAATGCCGGAGGCAAATCCGTTAACCTCTACAGCGGCAAACCGTAATCCCGAAGA
TCCGCTGGCTCAGTTAATGAGCGATAAACCGCTAGATATCGGTCAACAACCTAAGACAAGCAGCCTGTTT
GATGAAGAGGATGCACTGTTTGCTCAGGAAAGCATTTTTGATGACCGCACGCCCAGCACCTTGTCGGCAA
AACAAAATGCGCAAGGGCAGCCCAAAATAGAGGAAACCTCCACAGACGTGGACCCGTTAAATCTGTTTGG
CAGCCAGACCACGCCGGACCCGCGTCATCATGACGATCCGCTGGGGTTAATGATGAGCGGTGCCGTGCCG
CTGGCTCAGCCAGATATGCCGGTTTCGCAACCTGTGGCTGCGCCATCGCAGCCGAAAGAAAACCATCAGT
CTGCACCCTTGCAGCAGAAAGAACTCCATCAAGCGGCGCCATTACAGCCGCAAGAAAATCACCAGCCGAT
GCCAGATATCCTGGATACTGCACCGGTTGAGTTGGCTGATTTAAGCAGTTCACCGCTGTTTGATCACACT
GAAACGCAGGTCACTCACGATCCCGCTTTCGATCCTCAACCGCAGCCTGCCCAGCCTGAAGGAGCGCAAA
GCCCGATTGATTACGGCGGCATTACCTTGCCAACACCGCAGGCGGTGCAACGCACGCCTTCGCCCACGCC
AAAAGGGCGGCTGCGCATCGATCCGGTTGCCTCGCACAATAACAGCGGCGGGACCGAGCAGAGTGGCAAC
GCCAGTAGCGGCGATGCCTTAAAGGGCGAGTTGCTGGATGCACTGCTGGAAGGTATGGGCCTGCAGGATC
TGCAACCGACACCGCAGTTCGATCGCGAGCAGATGCGGCAGTTCGGCCAGATGCTCAGCATGTTCTCGCA
GGGAACGGTGGCACTGCTGTCTTCCCGATCGATTTTAAAACGCGGTGTAAAAGCCGACATGACCGTGATC
CTGGATGATGCTAACAACCCGTTTAAGCTGCTGCCGTCGGGTAAAACCGTATTGATGCAGATGTTTGGCA
GCCGTATGCCAGGTTTTATGCCGCCACGCCAGGCCGTGCGTGACGCTCTGATTGACCTCCAGGCGCACCA
GTTAGGGATGATTGCCGGGATTCGCGCCATTATTGCTTCCATGCTGCAGTCCTTTAACCCCGATCAGCTC
GAAGAAGAAGCGCGTCAAAACGGTTCCGTATCGCGCATTGGACTACCCGGCAGCCGTAAAGCCGCGCTGT
GGGAGCATTTTATCCAGCGCTATGGCGAAACTGCCGGTGAAATTGAAGATGACTTCCATACCTTGTTTGG
CGAAGCCTTCTTGCACGCGTACGACATGGAAGTAAATCAGTATAAAGACTCACAAACCCACACGGATGAC
GCATGA