SecReT6
Protein ID: 386016255
SecReT6 ID606
T6SS typei3
Gene symbol-
Locus tagPAJ_1665
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]2014998..2015480 [-]
Producthypothetical protein
NoteTssD
UniProt IDF2EX37
KEGG IDpaj:PAJ_1665
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-39, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|386016255|ref|YP_005934541.1| hypothetical protein PAJ_1665 [Pantoea ananatis AJ13355]
MAIDMYLKVDGITGESKDSNHTGWIDITSFSWGANQPGNMSVGGGGGAGKVNFNDLHINAKIDKAVTALL
KNCASGKHVTKVEVSVCKAGGTQIEYTRITLEDVLVTNVQFVGSEHDDTLGVTYAFQAAKVKQQYWEQSS
SGGKGAESSAGWNIKENKEA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c2015480-2014998 Pantoea ananatis AJ13355, complete genome
ATGGCTATTGATATGTATTTGAAGGTAGACGGTATTACTGGTGAATCTAAAGATTCAAACCATACCGGCT
GGATTGATATTACCTCTTTCTCCTGGGGCGCTAATCAGCCGGGTAATATGAGCGTGGGCGGCGGCGGCGG
TGCTGGTAAAGTAAACTTCAACGACCTGCACATTAATGCCAAAATCGACAAGGCTGTCACTGCGCTGTTG
AAAAACTGTGCCAGTGGTAAGCACGTCACTAAGGTTGAAGTTTCAGTTTGCAAGGCTGGCGGTACGCAAA
TCGAGTACACCCGCATCACCCTGGAAGACGTGCTGGTCACCAACGTACAGTTCGTGGGCTCTGAGCACGA
CGATACGCTGGGCGTAACCTATGCATTCCAGGCTGCGAAAGTGAAACAGCAGTACTGGGAGCAGAGCTCT
TCCGGTGGCAAAGGCGCAGAAAGCAGCGCTGGCTGGAATATCAAAGAGAACAAAGAAGCATAA