SecReT6
Protein ID: 386016256
SecReT6 ID606
T6SS typei3
Gene symbol-
Locus tagPAJ_1666
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]2016061..2017560 [-]
Producthypothetical protein
NoteTssC
UniProt IDF2EX38
KEGG IDpaj:PAJ_1666
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.00E-198, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|386016256|ref|YP_005934542.1| hypothetical protein PAJ_1666 [Pantoea ananatis AJ13355]
MNQTSQQPQSQGGASFSQDEFSALLNKEFRPKSDQAREAVESAVKTLAQQALENTVTMSSDAYRTIQALI
AEIDEKLSQQVNQIIHHDDFQKLESAWRGLSYLVNNTETDEMLKIRFMSISKQELSRTLKRYKGVGWDQS
PLFKKIYEQEYGQFGGEPFGCLVGDYYFDHSPQDVELLGEMARIGAAAHCPFITGTAPSVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEQTDGSDHSNYSWTN
AAYAMATNINRSFKEYGWCTSIRGVESGGAVEDLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDFAAFIGAQSLQKPAEYHDADATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVNVEEQEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKSNEN
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c2017560-2016061 Pantoea ananatis AJ13355, complete genome
ATGAACCAGACTTCTCAACAACCACAATCGCAGGGCGGTGCCAGCTTTAGTCAGGATGAGTTCAGCGCGT
TACTGAACAAAGAATTCCGTCCTAAAAGCGACCAGGCACGCGAAGCTGTAGAAAGCGCGGTAAAAACCCT
GGCGCAGCAGGCGCTGGAAAACACCGTGACCATGTCCAGCGATGCCTACCGCACCATTCAGGCGCTGATC
GCTGAGATTGACGAAAAGCTGTCTCAGCAGGTTAACCAGATCATCCACCATGATGACTTTCAGAAGCTGG
AAAGCGCCTGGCGTGGTCTGAGCTATCTGGTGAATAACACCGAAACTGATGAGATGCTCAAGATTCGCTT
TATGAGCATCTCCAAGCAGGAACTGAGCCGCACTCTGAAACGCTATAAAGGCGTGGGCTGGGATCAGAGC
CCGCTGTTCAAGAAAATCTACGAGCAGGAATATGGCCAGTTTGGTGGTGAACCTTTTGGCTGCCTGGTGG
GCGACTACTATTTCGATCACAGCCCGCAGGACGTTGAGCTGCTGGGCGAGATGGCGCGTATCGGTGCTGC
AGCACACTGTCCGTTTATCACCGGTACTGCACCAAGCGTGATGCAGATGGAATCCTGGCAGGAACTGGCA
AACCCACGCGATCTGACCAAAATCTTCCAGAATACCGAATATGCTGCCTGGCGTAGCCTGCGCGAGTCTG
AAGACGCGCGCTATCTGGGCCTGGTGATGCCGCGCTTCCTGTCTCGTCTGCCTTACGGTATTCGCACCAA
CCCCGTGGACAGCTTTGATTTTGAAGAGCAGACCGACGGTTCCGACCACAGCAACTACAGCTGGACCAAC
GCGGCTTATGCCATGGCGACTAACATCAACCGTTCCTTCAAGGAGTACGGCTGGTGTACATCTATTCGCG
GCGTGGAGTCGGGTGGGGCCGTTGAAGATCTGCCTTGCCACACGTTCCCAAGCGATGACGGCGGCGTAGA
CATGAAATGCCCAACGGAAATCGCCATCAGCGATCGCCGCGAAGCCGAGCTCGCGAAGAATGGCTTTATG
CCGTTAGTTCACCGCAAAAACTCTGACTTTGCCGCCTTTATCGGCGCCCAGTCGCTGCAAAAGCCTGCGG
AGTACCACGATGCTGACGCCACCGCCAATGCGCGTCTGGCAGCGCGGCTGCCTTATCTGTTCGCCTGCTG
CCGTTTCGCTCACTATCTGAAGTGTATTGTGCGCGACAAGATTGGTTCCTTCCGCGAGCGCGACGAAATG
GAACGCTGGTTGAACGACTGGGTGATGAACTATGTCGATGGTGACCCGGCTAACTCTTCTCAGGAAACCA
AGTCTCGTAAGCCGCTGGCTGCTGCAGAAGTGAATGTGGAAGAGCAGGAGGACAACCCAGGCTACTATGC
TGCAAAATTCTTCCTGCGTCCGCATTACCAGTTGGAAGGGTTAACCGTTTCGCTGCGTCTGGTATCGAAA
CTGCCTTCGCTGAAGTCGAACGAAAACTAA