SecReT6
Protein ID: 386016257
SecReT6 ID606
T6SS typei3
Gene symbol-
Locus tagPAJ_1667
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]2017560..2018102 [-]
Producthypothetical protein
NoteTssB
UniProt IDF2EX39
KEGG IDpaj:PAJ_1667
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.00E-60, Aligned region: 16..168
Protein Sequence: 180 a.a.     [Download]
>gi|386016257|ref|YP_005934543.1| hypothetical protein PAJ_1667 [Pantoea ananatis AJ13355]
MERTMPTMKSSGQKFIARNRAPRVQIEYDVEVYGAERKIQLPFIMGVLADLAGKPLEPQASVDDRKFMEI
DIDNFDERMKAMKPRAAFQVDNTLNGDGKLNIDLTFESMDDFSPDAIARKVDPLNSLLEARTQLSNLLTY
MDGKNGAEELIGKILQDPTLLQALSHVPKQTDAPEGKEEQ
 
Nucleotide Sequence: 543 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c2018102-2017560 Pantoea ananatis AJ13355, complete genome
ATGGAGAGAACCATGCCAACAATGAAGTCCAGTGGGCAGAAATTTATCGCCCGCAATCGCGCGCCACGCG
TTCAGATTGAATATGACGTGGAAGTCTATGGCGCAGAACGTAAAATTCAGCTGCCATTCATCATGGGTGT
TCTGGCCGATTTAGCCGGTAAACCGCTGGAGCCGCAGGCCAGCGTTGACGACCGTAAATTCATGGAAATC
GACATCGACAATTTCGATGAGCGTATGAAAGCCATGAAGCCACGTGCGGCATTCCAGGTAGACAATACGT
TGAACGGTGACGGCAAACTGAACATCGATCTGACCTTCGAAAGCATGGACGATTTTTCTCCTGATGCCAT
TGCACGCAAAGTCGATCCACTCAACAGCCTGCTTGAAGCACGTACCCAGCTCTCCAACCTGCTGACCTAT
ATGGACGGCAAAAACGGCGCCGAAGAGCTGATCGGCAAGATTTTACAGGATCCGACACTGCTGCAGGCCC
TGTCACACGTGCCTAAGCAAACGGATGCCCCTGAAGGTAAGGAGGAGCAGTAA