SecReT6
Protein ID: 386016258
SecReT6 ID606
T6SS typei3
Gene symbol-
Locus tagPAJ_1668
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]2018171..2019193 [-]
ProductImpA-related N-Terminal family
NoteTssA
UniProt IDF2EX40
KEGG IDpaj:PAJ_1668
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-20, Aligned region: 54..113
Protein Sequence: 340 a.a.     [Download]
>gi|386016258|ref|YP_005934544.1| ImpA-related N-Terminal family, partial [Pantoea ananatis AJ13355]
MSIDIDTLLIPVSHDNPCGENLEYDADFQAMEQASVGKAEQQFGNTIIPAEPADWNKVEKLALELMSRSK
DLRVMLTLTHAWTRLKGLPGYAQGLQLIEQAMLQFWEPLWPRLEEDGEHDPFYRINALAVLGDQSALTAA
VRQSWLMRYASDGITLRDASALCDGSKTEVPDYPGGLPRLNDELARGEQPGIAAIQNIAERLQNIRRIVI
EKLDETALPDMSQLQRSMAMLNERCQATDMESLHSLAAAMQSAPATEQQPSVAAPRAATDWRSAQLNSRA
EAQLMLEKVKQYFSQHEPSHPAPLMIDRVQRLIELDFMDIIRDLAPDGVHQLENIFGRRD
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c2019193-2018171 Pantoea ananatis AJ13355, complete genome
ATGAGTATTGATATTGACACGTTGCTGATACCGGTAAGCCATGATAATCCGTGCGGTGAAAACCTGGAGT
ACGACGCGGACTTTCAGGCGATGGAGCAGGCCAGCGTGGGAAAAGCCGAACAGCAGTTCGGTAACACCAT
TATTCCGGCTGAGCCAGCGGACTGGAACAAAGTTGAAAAGCTTGCACTGGAACTGATGAGCCGCAGCAAA
GACCTGCGTGTCATGCTGACCCTGACACATGCCTGGACGCGCCTGAAAGGGTTACCGGGCTATGCACAGG
GCCTGCAACTGATTGAACAGGCGATGTTGCAGTTCTGGGAACCGCTCTGGCCTCGCCTTGAAGAAGATGG
CGAGCACGATCCGTTTTACCGCATCAACGCGCTGGCTGTGCTGGGCGATCAGTCGGCACTTACGGCCGCC
GTTCGTCAGTCATGGCTCATGCGCTATGCGTCCGATGGTATTACGCTGCGTGATGCTTCGGCGCTGTGTG
ACGGCAGTAAAACAGAGGTGCCAGATTATCCGGGTGGGCTGCCGCGTCTGAATGACGAACTTGCACGAGG
GGAACAACCGGGCATCGCAGCGATTCAAAACATTGCTGAGCGTTTGCAAAATATTCGCCGCATCGTGATT
GAAAAGCTGGATGAAACGGCCTTGCCGGATATGAGTCAGCTGCAACGCAGCATGGCAATGCTGAATGAGC
GCTGTCAGGCCACGGATATGGAATCGTTACACTCCCTGGCGGCGGCGATGCAATCCGCACCCGCAACGGA
GCAGCAGCCCAGCGTCGCTGCACCACGTGCGGCTACCGACTGGCGCAGTGCCCAACTGAATTCGCGGGCA
GAAGCCCAACTTATGCTGGAAAAGGTCAAACAGTACTTTAGTCAGCATGAGCCGAGCCACCCGGCACCGC
TGATGATTGACAGGGTACAGCGCCTTATCGAACTCGATTTTATGGACATCATTCGCGATCTCGCGCCCGA
TGGTGTGCATCAGTTAGAAAACATTTTTGGACGCCGCGACTAA