SecReT6
Protein ID: 386016261
SecReT6 ID606
T6SS typei3
Gene symbolytxE
Locus tagPAJ_1671
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]2023563..2024804 [-]
Productflagellar motor protein YtxE
NoteTssL
UniProt IDF2EX43
KEGG IDpaj:PAJ_1671
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.30E-71, Aligned region: 21..226
OmpA [PF00691], Evalue: 1.80E-16, Aligned region: 291..389
Protein Sequence: 413 a.a.     [Download]
>gi|386016261|ref|YP_005934547.1| flagellar motor protein YtxE [Pantoea ananatis AJ13355]
MMQEQNKPNSDAFQQDLSHQNSLVAAANPLINAIPQIRHSVSHDDPARLRQQLIDQIRRFELACQQSGLS
YEVIVGARYCLCTALDEAAALTPWGSRGVWTSNGLLVTFHNETWGGEKFFQLLAKLSQNPRQHILLLELI
YFCLLLGFEGRYRVLDNGRSQLDTIKQRLLQMIRSVRGSFAAALSPHPTDQPVLRKLWRPMIPLWACAAL
AGLAACLFYIVLNWRLGDYTSPVLAKIYQTTLPEVQIRNPAPPPPPSLNLKSFLKPEIDEGLVAVRDEAD
QSVVTLKGDGLFASGSTEVRGRYDAVIQRVAEAMNNVSGKILVVGYSDNVPIRSARFASNYELSLARAQS
VQTLLQKQLAKPSRVKAEGRGETHPLVPNTSAENRARNRRVEITLQVAPDTTQAEVNGLARGN
 
Nucleotide Sequence: 1242 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c2024804-2023563 Pantoea ananatis AJ13355, complete genome
ATGATGCAGGAACAAAATAAACCGAACAGTGATGCTTTTCAGCAGGATCTTAGCCACCAGAATAGTTTGG
TGGCTGCAGCGAATCCGCTGATTAACGCGATTCCACAGATTCGTCACTCCGTCTCCCATGACGATCCCGC
ACGTTTACGTCAACAGCTTATTGACCAGATCCGCCGTTTCGAGCTGGCCTGCCAGCAGTCCGGACTGAGC
TATGAGGTGATCGTTGGCGCGCGCTATTGTCTGTGTACGGCGCTTGATGAAGCCGCAGCACTGACGCCCT
GGGGAAGCCGTGGCGTGTGGACCAGTAATGGCTTACTGGTAACCTTCCACAACGAAACCTGGGGCGGGGA
GAAATTCTTCCAACTGCTGGCGAAACTGTCGCAAAACCCGCGTCAGCACATCCTGTTACTGGAGCTGATC
TATTTCTGCTTACTGCTTGGTTTTGAAGGGCGCTATCGGGTTCTGGATAATGGACGCTCGCAACTGGATA
CGATTAAACAGCGTCTGTTGCAGATGATCAGGAGCGTCAGGGGCAGCTTTGCCGCCGCCTTGTCGCCGCA
TCCGACCGATCAGCCGGTTCTGCGTAAACTCTGGCGCCCCATGATTCCGCTGTGGGCCTGTGCGGCTCTG
GCGGGCCTGGCTGCCTGCCTGTTCTATATCGTGCTGAACTGGCGTCTGGGGGATTACACCTCGCCCGTGC
TGGCCAAAATCTACCAAACGACGCTGCCAGAAGTGCAGATTCGTAATCCGGCACCGCCGCCGCCGCCGTC
ACTGAACCTGAAGTCATTCCTGAAACCTGAAATCGACGAAGGCCTGGTGGCCGTGCGCGATGAGGCAGAT
CAAAGTGTGGTGACGTTGAAAGGCGATGGCTTGTTCGCATCCGGTTCGACAGAGGTTCGCGGACGTTATG
ATGCCGTTATCCAGCGTGTAGCTGAAGCCATGAATAACGTCAGCGGGAAAATCCTGGTGGTGGGCTACAG
CGATAACGTACCGATTCGCAGTGCCCGATTTGCCTCCAACTATGAGCTGTCTCTGGCCCGTGCCCAGTCT
GTTCAGACGCTGTTACAAAAACAGCTGGCAAAACCATCACGCGTTAAAGCGGAAGGGCGGGGTGAAACGC
ATCCGTTGGTGCCGAATACCAGTGCAGAAAATCGCGCGCGTAATCGTCGTGTTGAAATTACGCTGCAGGT
TGCACCTGATACGACGCAAGCTGAAGTTAACGGCCTGGCGAGAGGGAACTAA